BDGP Sequence Production Resources |
Search the DGRC for IP04682
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 46 |
Well: | 82 |
Vector: | pOT2 |
Associated Gene/Transcript | CG31469-RA |
Protein status: | IP04682.pep: gold |
Preliminary Size: | 429 |
Sequenced Size: | 627 |
Gene | Date | Evidence |
---|---|---|
CG31469 | 2005-01-01 | Successful iPCR screen |
CG31469 | 2008-04-29 | Release 5.5 accounting |
CG31469 | 2008-08-15 | Release 5.9 accounting |
CG31469 | 2008-12-18 | 5.12 accounting |
627 bp (627 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022290
> IP04682.complete CGAAAATGAAGGTTCTGTTCGTGTGCATTGGCAACACATGCCGGTCACCA ATGGCCGAGGCCATACTGAAGCATTTGGTAGTGAAACGGAATCTGCAGGA CTGGTATGTGGACAGTGCTGGCCTCAGGAGTTGGAACGTTGGCCTGGAGC CCCAGGCACGTGGACAACAATTGTTAAAACAGCATGGTTTGAAAACAAAC CACTTGGGTCGTATGATAAGCGCTCAAGACTTCTATGACTTCGATTACAT ATTCGCCATGGACAATAGCAACCTATTGGAGCTTGAGCATATGGCTGCTT CTCTTACTCCCAGTCCGACATGCAAGATTCAATTGCTGGGTAGCTATATT GGACGCAAGGAGGATGAGATCATCGAGGATCCATACTTTATTCAAGGCAT GGGAGGCTTTAATGCTGCATATCTGCAGATTCTGGAAAGCTGCGAACGAT TTCTGCAACATTATAAATCGGATGACAAGGAGTTATCATTAGGAAGTTAA TAGAAGTGTCATCATTCATTGTTTGGTATAGGGTTATTTCCTATTTCGTT GCTGAATAAGTTCATGTCCAGCTGACTATTTCTTATTAAAAAGAGCAAAT TGAAACTTAGCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31469-RA | 654 | CG31469-RA | 40..651 | 1..612 | 3060 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 9534046..9534265 | 611..392 | 1100 | 100 | Minus |
chr3R | 27901430 | chr3R | 9534553..9534742 | 219..30 | 890 | 97.9 | Minus |
chr3R | 27901430 | chr3R | 9534326..9534500 | 389..215 | 830 | 98.3 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 13709160..13709382 | 612..390 | 1115 | 100 | Minus |
3R | 32079331 | 3R | 13709668..13709857 | 219..30 | 935 | 99.5 | Minus |
3R | 32079331 | 3R | 13709441..13709615 | 389..215 | 875 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 13449991..13450213 | 612..390 | 1115 | 100 | Minus |
3R | 31820162 | 3R | 13450499..13450688 | 219..30 | 935 | 99.4 | Minus |
3R | 31820162 | 3R | 13450272..13450446 | 389..215 | 875 | 100 | Minus |
3R | 31820162 | 3R | 13450740..13450770 | 31..1 | 155 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9534046..9534267 | 390..611 | 99 | <- | Minus |
chr3R | 9534326..9534499 | 216..389 | 98 | <- | Minus |
chr3R | 9534557..9534741 | 31..215 | 98 | <- | Minus |
chr3R | 9534795..9534824 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..495 | 6..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..495 | 6..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..495 | 6..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..495 | 6..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..495 | 6..500 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 32..642 | 1..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..611 | 1..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..611 | 1..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 32..642 | 1..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31469-RA | 1..611 | 1..611 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13709161..13709382 | 390..611 | 100 | <- | Minus |
3R | 13709441..13709614 | 216..389 | 100 | <- | Minus |
3R | 13709672..13709856 | 31..215 | 100 | <- | Minus |
3R | 13709910..13709939 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13709161..13709382 | 390..611 | 100 | <- | Minus |
3R | 13709441..13709614 | 216..389 | 100 | <- | Minus |
3R | 13709672..13709856 | 31..215 | 100 | <- | Minus |
3R | 13709910..13709939 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13709161..13709382 | 390..611 | 100 | <- | Minus |
3R | 13709441..13709614 | 216..389 | 100 | <- | Minus |
3R | 13709672..13709856 | 31..215 | 100 | <- | Minus |
3R | 13709910..13709939 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9534883..9535104 | 390..611 | 100 | <- | Minus |
arm_3R | 9535163..9535336 | 216..389 | 100 | <- | Minus |
arm_3R | 9535394..9535578 | 31..215 | 100 | <- | Minus |
arm_3R | 9535632..9535661 | 1..30 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13449992..13450213 | 390..611 | 100 | <- | Minus |
3R | 13450272..13450445 | 216..389 | 100 | <- | Minus |
3R | 13450503..13450687 | 31..215 | 100 | <- | Minus |
3R | 13450741..13450770 | 1..30 | 100 | Minus |
Translation from 2 to 499
> IP04682.pep KMKVLFVCIGNTCRSPMAEAILKHLVVKRNLQDWYVDSAGLRSWNVGLEP QARGQQLLKQHGLKTNHLGRMISAQDFYDFDYIFAMDNSNLLELEHMAAS LTPSPTCKIQLLGSYIGRKEDEIIEDPYFIQGMGGFNAAYLQILESCERF LQHYKSDDKELSLGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18148-PA | 157 | GF18148-PA | 1..157 | 2..158 | 659 | 75.2 | Plus |
Dana\GF18146-PA | 164 | GF18146-PA | 7..162 | 1..158 | 332 | 39 | Plus |
Dana\GF18147-PA | 155 | GF18147-PA | 4..151 | 3..153 | 326 | 40.4 | Plus |
Dana\GF23217-PA | 294 | GF23217-PA | 5..159 | 3..157 | 297 | 39.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17027-PA | 165 | GG17027-PA | 1..163 | 2..164 | 821 | 90.8 | Plus |
Dere\GG17025-PA | 155 | GG17025-PA | 4..151 | 3..153 | 327 | 41.1 | Plus |
Dere\GG17024-PA | 164 | GG17024-PA | 7..159 | 1..155 | 311 | 39.7 | Plus |
Dere\GG23073-PA | 249 | GG23073-PA | 5..152 | 3..151 | 299 | 40.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14047-PA | 155 | GH14047-PA | 1..155 | 2..156 | 613 | 69 | Plus |
Dgri\GH14046-PA | 155 | GH14046-PA | 4..151 | 3..153 | 338 | 43 | Plus |
Dgri\GH14482-PA | 234 | GH14482-PA | 5..150 | 3..151 | 281 | 39.6 | Plus |
Dgri\GH14045-PA | 168 | GH14045-PA | 11..163 | 4..156 | 270 | 34.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31469-PA | 164 | CG31469-PA | 1..164 | 2..165 | 864 | 100 | Plus |
primo-2-PC | 164 | CG33747-PC | 7..156 | 1..152 | 328 | 42.5 | Plus |
primo-1-PB | 155 | CG33748-PB | 4..150 | 3..152 | 318 | 41.3 | Plus |
primo-1-PA | 155 | CG33748-PA | 4..150 | 3..152 | 318 | 41.3 | Plus |
CG14297-PA | 250 | CG14297-PA | 5..166 | 3..165 | 305 | 40.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24422-PA | 157 | GI24422-PA | 1..154 | 2..155 | 512 | 57.1 | Plus |
Dmoj\GI24420-PA | 156 | GI24420-PA | 5..152 | 3..153 | 337 | 42.5 | Plus |
Dmoj\GI24419-PA | 165 | GI24419-PA | 7..164 | 1..158 | 301 | 40.4 | Plus |
Dmoj\GI22967-PA | 239 | GI22967-PA | 5..152 | 3..151 | 291 | 40.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24449-PA | 165 | GL24449-PA | 1..164 | 2..165 | 666 | 72 | Plus |
Dper\GL24448-PA | 159 | GL24448-PA | 7..156 | 1..153 | 313 | 39.9 | Plus |
Dper\GL23438-PA | 260 | GL23438-PA | 5..152 | 3..151 | 310 | 42.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16272-PA | 165 | GA16272-PA | 1..164 | 2..165 | 665 | 72.6 | Plus |
Dpse\GA16170-PB | 154 | GA16170-PB | 4..151 | 3..153 | 316 | 39.7 | Plus |
Dpse\GA12886-PA | 260 | GA12886-PA | 5..152 | 3..151 | 309 | 42.3 | Plus |
Dpse\GA16170-PC | 137 | GA16170-PC | 4..134 | 3..136 | 275 | 38.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25911-PA | 159 | GM25911-PA | 1..159 | 2..160 | 826 | 95.6 | Plus |
Dsec\GM25909-PA | 155 | GM25909-PA | 4..151 | 3..153 | 324 | 40.4 | Plus |
Dsec\GM17892-PA | 250 | GM17892-PA | 5..158 | 3..157 | 323 | 42.6 | Plus |
Dsec\GM25908-PA | 164 | GM25908-PA | 7..159 | 1..155 | 313 | 38.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20478-PA | 165 | GD20478-PA | 1..164 | 2..165 | 838 | 94.5 | Plus |
Dsim\GD19253-PA | 250 | GD19253-PA | 5..158 | 3..157 | 321 | 41.9 | Plus |
Dsim\GD20476-PA | 164 | GD20476-PA | 7..157 | 1..153 | 320 | 40.3 | Plus |
Dsim\GD20477-PA | 150 | GD20477-PA | 4..146 | 3..153 | 316 | 42.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14280-PA | 157 | GJ14280-PA | 1..153 | 2..154 | 607 | 69.9 | Plus |
Dvir\GJ14279-PA | 155 | GJ14279-PA | 4..151 | 3..153 | 329 | 42.1 | Plus |
Dvir\GJ14544-PA | 235 | GJ14544-PA | 5..152 | 3..151 | 310 | 41.6 | Plus |
Dvir\GJ14278-PA | 168 | GJ14278-PA | 11..165 | 4..158 | 289 | 38 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13064-PA | 160 | GK13064-PA | 1..157 | 2..158 | 601 | 66.2 | Plus |
Dwil\GK13063-PA | 155 | GK13063-PA | 4..150 | 3..152 | 320 | 40 | Plus |
Dwil\GK13060-PA | 164 | GK13060-PA | 8..162 | 3..158 | 304 | 36.7 | Plus |
Dwil\GK22744-PA | 228 | GK22744-PA | 5..155 | 3..151 | 299 | 42.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24419-PA | 165 | GE24419-PA | 1..163 | 2..164 | 817 | 91.4 | Plus |
Dyak\primo-1-PA | 155 | GE24418-PA | 4..151 | 3..153 | 327 | 41.1 | Plus |
Dyak\GE25562-PA | 249 | GE25562-PA | 5..166 | 3..165 | 303 | 39.9 | Plus |
Dyak\GE24417-PA | 164 | GE24417-PA | 7..159 | 1..155 | 298 | 38.5 | Plus |
Translation from 2 to 499
> IP04682.hyp KMKVLFVCIGNTCRSPMAEAILKHLVVKRNLQDWYVDSAGLRSWNVGLEP QARGQQLLKQHGLKTNHLGRMISAQDFYDFDYIFAMDNSNLLELEHMAAS LTPSPTCKIQLLGSYIGRKEDEIIEDPYFIQGMGGFNAAYLQILESCERF LQHYKSDDKELSLGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31469-PA | 164 | CG31469-PA | 1..164 | 2..165 | 864 | 100 | Plus |
primo-2-PC | 164 | CG33747-PC | 7..156 | 1..152 | 328 | 42.5 | Plus |
primo-1-PB | 155 | CG33748-PB | 4..150 | 3..152 | 318 | 41.3 | Plus |
primo-1-PA | 155 | CG33748-PA | 4..150 | 3..152 | 318 | 41.3 | Plus |
CG14297-PA | 250 | CG14297-PA | 5..166 | 3..165 | 305 | 40.5 | Plus |