Clone IP04682 Report

Search the DGRC for IP04682

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:82
Vector:pOT2
Associated Gene/TranscriptCG31469-RA
Protein status:IP04682.pep: gold
Preliminary Size:429
Sequenced Size:627

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31469 2005-01-01 Successful iPCR screen
CG31469 2008-04-29 Release 5.5 accounting
CG31469 2008-08-15 Release 5.9 accounting
CG31469 2008-12-18 5.12 accounting

Clone Sequence Records

IP04682.complete Sequence

627 bp (627 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022290

> IP04682.complete
CGAAAATGAAGGTTCTGTTCGTGTGCATTGGCAACACATGCCGGTCACCA
ATGGCCGAGGCCATACTGAAGCATTTGGTAGTGAAACGGAATCTGCAGGA
CTGGTATGTGGACAGTGCTGGCCTCAGGAGTTGGAACGTTGGCCTGGAGC
CCCAGGCACGTGGACAACAATTGTTAAAACAGCATGGTTTGAAAACAAAC
CACTTGGGTCGTATGATAAGCGCTCAAGACTTCTATGACTTCGATTACAT
ATTCGCCATGGACAATAGCAACCTATTGGAGCTTGAGCATATGGCTGCTT
CTCTTACTCCCAGTCCGACATGCAAGATTCAATTGCTGGGTAGCTATATT
GGACGCAAGGAGGATGAGATCATCGAGGATCCATACTTTATTCAAGGCAT
GGGAGGCTTTAATGCTGCATATCTGCAGATTCTGGAAAGCTGCGAACGAT
TTCTGCAACATTATAAATCGGATGACAAGGAGTTATCATTAGGAAGTTAA
TAGAAGTGTCATCATTCATTGTTTGGTATAGGGTTATTTCCTATTTCGTT
GCTGAATAAGTTCATGTCCAGCTGACTATTTCTTATTAAAAAGAGCAAAT
TGAAACTTAGCAAAAAAAAAAAAAAAA

IP04682.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31469-RA 654 CG31469-RA 40..651 1..612 3060 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9534046..9534265 611..392 1100 100 Minus
chr3R 27901430 chr3R 9534553..9534742 219..30 890 97.9 Minus
chr3R 27901430 chr3R 9534326..9534500 389..215 830 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13709160..13709382 612..390 1115 100 Minus
3R 32079331 3R 13709668..13709857 219..30 935 99.5 Minus
3R 32079331 3R 13709441..13709615 389..215 875 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13449991..13450213 612..390 1115 100 Minus
3R 31820162 3R 13450499..13450688 219..30 935 99.4 Minus
3R 31820162 3R 13450272..13450446 389..215 875 100 Minus
3R 31820162 3R 13450740..13450770 31..1 155 100 Minus
Blast to na_te.dros performed on 2019-03-16 08:33:14 has no hits.

IP04682.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:34:21 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9534046..9534267 390..611 99 <- Minus
chr3R 9534326..9534499 216..389 98 <- Minus
chr3R 9534557..9534741 31..215 98 <- Minus
chr3R 9534795..9534824 1..30 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:02 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..495 6..500 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:02 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..495 6..500 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:49 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..495 6..500 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:02 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..495 6..500 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:08 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..495 6..500 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:45 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 32..642 1..611 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:02 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..611 1..611 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:49 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..611 1..611 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:02 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 32..642 1..611 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:08 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
CG31469-RA 1..611 1..611 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:21 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13709161..13709382 390..611 100 <- Minus
3R 13709441..13709614 216..389 100 <- Minus
3R 13709672..13709856 31..215 100 <- Minus
3R 13709910..13709939 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:21 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13709161..13709382 390..611 100 <- Minus
3R 13709441..13709614 216..389 100 <- Minus
3R 13709672..13709856 31..215 100 <- Minus
3R 13709910..13709939 1..30 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:34:21 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13709161..13709382 390..611 100 <- Minus
3R 13709441..13709614 216..389 100 <- Minus
3R 13709672..13709856 31..215 100 <- Minus
3R 13709910..13709939 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:49 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9534883..9535104 390..611 100 <- Minus
arm_3R 9535163..9535336 216..389 100 <- Minus
arm_3R 9535394..9535578 31..215 100 <- Minus
arm_3R 9535632..9535661 1..30 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:19 Download gff for IP04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13449992..13450213 390..611 100 <- Minus
3R 13450272..13450445 216..389 100 <- Minus
3R 13450503..13450687 31..215 100 <- Minus
3R 13450741..13450770 1..30 100   Minus

IP04682.pep Sequence

Translation from 2 to 499

> IP04682.pep
KMKVLFVCIGNTCRSPMAEAILKHLVVKRNLQDWYVDSAGLRSWNVGLEP
QARGQQLLKQHGLKTNHLGRMISAQDFYDFDYIFAMDNSNLLELEHMAAS
LTPSPTCKIQLLGSYIGRKEDEIIEDPYFIQGMGGFNAAYLQILESCERF
LQHYKSDDKELSLGS*

IP04682.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18148-PA 157 GF18148-PA 1..157 2..158 659 75.2 Plus
Dana\GF18146-PA 164 GF18146-PA 7..162 1..158 332 39 Plus
Dana\GF18147-PA 155 GF18147-PA 4..151 3..153 326 40.4 Plus
Dana\GF23217-PA 294 GF23217-PA 5..159 3..157 297 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17027-PA 165 GG17027-PA 1..163 2..164 821 90.8 Plus
Dere\GG17025-PA 155 GG17025-PA 4..151 3..153 327 41.1 Plus
Dere\GG17024-PA 164 GG17024-PA 7..159 1..155 311 39.7 Plus
Dere\GG23073-PA 249 GG23073-PA 5..152 3..151 299 40.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14047-PA 155 GH14047-PA 1..155 2..156 613 69 Plus
Dgri\GH14046-PA 155 GH14046-PA 4..151 3..153 338 43 Plus
Dgri\GH14482-PA 234 GH14482-PA 5..150 3..151 281 39.6 Plus
Dgri\GH14045-PA 168 GH14045-PA 11..163 4..156 270 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG31469-PA 164 CG31469-PA 1..164 2..165 864 100 Plus
primo-2-PC 164 CG33747-PC 7..156 1..152 328 42.5 Plus
primo-1-PB 155 CG33748-PB 4..150 3..152 318 41.3 Plus
primo-1-PA 155 CG33748-PA 4..150 3..152 318 41.3 Plus
CG14297-PA 250 CG14297-PA 5..166 3..165 305 40.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24422-PA 157 GI24422-PA 1..154 2..155 512 57.1 Plus
Dmoj\GI24420-PA 156 GI24420-PA 5..152 3..153 337 42.5 Plus
Dmoj\GI24419-PA 165 GI24419-PA 7..164 1..158 301 40.4 Plus
Dmoj\GI22967-PA 239 GI22967-PA 5..152 3..151 291 40.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24449-PA 165 GL24449-PA 1..164 2..165 666 72 Plus
Dper\GL24448-PA 159 GL24448-PA 7..156 1..153 313 39.9 Plus
Dper\GL23438-PA 260 GL23438-PA 5..152 3..151 310 42.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16272-PA 165 GA16272-PA 1..164 2..165 665 72.6 Plus
Dpse\GA16170-PB 154 GA16170-PB 4..151 3..153 316 39.7 Plus
Dpse\GA12886-PA 260 GA12886-PA 5..152 3..151 309 42.3 Plus
Dpse\GA16170-PC 137 GA16170-PC 4..134 3..136 275 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25911-PA 159 GM25911-PA 1..159 2..160 826 95.6 Plus
Dsec\GM25909-PA 155 GM25909-PA 4..151 3..153 324 40.4 Plus
Dsec\GM17892-PA 250 GM17892-PA 5..158 3..157 323 42.6 Plus
Dsec\GM25908-PA 164 GM25908-PA 7..159 1..155 313 38.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20478-PA 165 GD20478-PA 1..164 2..165 838 94.5 Plus
Dsim\GD19253-PA 250 GD19253-PA 5..158 3..157 321 41.9 Plus
Dsim\GD20476-PA 164 GD20476-PA 7..157 1..153 320 40.3 Plus
Dsim\GD20477-PA 150 GD20477-PA 4..146 3..153 316 42.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:44:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14280-PA 157 GJ14280-PA 1..153 2..154 607 69.9 Plus
Dvir\GJ14279-PA 155 GJ14279-PA 4..151 3..153 329 42.1 Plus
Dvir\GJ14544-PA 235 GJ14544-PA 5..152 3..151 310 41.6 Plus
Dvir\GJ14278-PA 168 GJ14278-PA 11..165 4..158 289 38 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13064-PA 160 GK13064-PA 1..157 2..158 601 66.2 Plus
Dwil\GK13063-PA 155 GK13063-PA 4..150 3..152 320 40 Plus
Dwil\GK13060-PA 164 GK13060-PA 8..162 3..158 304 36.7 Plus
Dwil\GK22744-PA 228 GK22744-PA 5..155 3..151 299 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24419-PA 165 GE24419-PA 1..163 2..164 817 91.4 Plus
Dyak\primo-1-PA 155 GE24418-PA 4..151 3..153 327 41.1 Plus
Dyak\GE25562-PA 249 GE25562-PA 5..166 3..165 303 39.9 Plus
Dyak\GE24417-PA 164 GE24417-PA 7..159 1..155 298 38.5 Plus

IP04682.hyp Sequence

Translation from 2 to 499

> IP04682.hyp
KMKVLFVCIGNTCRSPMAEAILKHLVVKRNLQDWYVDSAGLRSWNVGLEP
QARGQQLLKQHGLKTNHLGRMISAQDFYDFDYIFAMDNSNLLELEHMAAS
LTPSPTCKIQLLGSYIGRKEDEIIEDPYFIQGMGGFNAAYLQILESCERF
LQHYKSDDKELSLGS*

IP04682.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG31469-PA 164 CG31469-PA 1..164 2..165 864 100 Plus
primo-2-PC 164 CG33747-PC 7..156 1..152 328 42.5 Plus
primo-1-PB 155 CG33748-PB 4..150 3..152 318 41.3 Plus
primo-1-PA 155 CG33748-PA 4..150 3..152 318 41.3 Plus
CG14297-PA 250 CG14297-PA 5..166 3..165 305 40.5 Plus