Clone IP04685 Report

Search the DGRC for IP04685

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:85
Vector:pOT2
Associated Gene/TranscriptApf-RA
Protein status:IP04685.pep: gold
Preliminary Size:446
Sequenced Size:805

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31713 2005-01-01 Successful iPCR screen
Apf 2008-04-29 Release 5.5 accounting
Apf 2008-08-15 Release 5.9 accounting
Apf 2008-12-18 5.12 accounting
CG31713 2011-03-01 Transcript Validation

Clone Sequence Records

IP04685.complete Sequence

805 bp (805 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022285

> IP04685.complete
ATGGACGTTTGTAGTAATGTTGAAATTGAGAGTACCGAAGATTCCATTGT
TACGGGCTTAAACTCTGGTAACGCTGAAGATGTCGATATGACACCTGGAT
GGCGGCGAAAGCGTAACCAGAAATCGAAAAAAAGCTACATCGGCACTAAA
GATGTGTTGGATCAGACGTTAGACAAGGATATACCACTTAACAAACAGAA
CCGCAGATTTCCTATTACTGCACATTCGCGCTTAACCGGACGTCTCGTGC
CGAATTCGGCACGAGGTTAATTGATAGCAACAACATGGAAAAGGCAGCTG
GTTTTGTTATTTTTCGCCGCCTTTGTGGGGAAATACAATACCTATTGCTG
AAGGCTTCCTACGGCTCCTTCCACTGGAGTTCTCCCAAGGGACATGTGGA
CCCAGGCGAGGATGATTTTACCACTGCCCTGCGAGAAACGAAAGAGGAAG
CCGGGTACGACGAGAAGGATCTGATCATATACAAGGACACTCCGCTGACC
CTGAATTATCAGGTGCAAGACAAGCCGAAGATTGTTATTTACTGGCTAGC
GGAGCTGCGGAATCCCTGCCAGGAGCCCATTCTCTCCGAGGAGCACACCG
ACCTCAAGTGGCTGCCCAAGGAGGAGGCCAAGCAGTGCGTCGGCTTTAAG
GATAACCAAGTCATGATCGACAAGTTCCACCAAATGATTTTAGATCAAAA
CAAACCAATGTGAACTGAAAACAATTGCCGGTCTAATGTTGGGCAACACA
GAAATTAAAATAAAAAAAGCACAGAAAATACCGTATCAAAAAAAAAAAAA
AAAAA

IP04685.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31713-RA 560 CG31713-RA 30..560 265..795 2655 100 Plus
E(bx)-RF 7944 E(bx)-RF 4068..4290 1..223 1115 100 Plus
E(bx)-RC 8004 E(bx)-RC 4068..4290 1..223 1115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9937090..9937423 787..454 1670 100 Minus
chr3L 24539361 chr3L 242146..242368 223..1 1115 100 Minus
chr2L 23010047 chr2L 9937480..9937670 455..265 955 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9938170..9938511 795..454 1710 100 Minus
3L 28110227 3L 242191..242413 223..1 1115 100 Minus
2L 23513712 2L 9938568..9938758 455..265 955 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9938170..9938511 795..454 1710 100 Minus
3L 28103327 3L 242191..242413 223..1 1115 100 Minus
2L 23513712 2L 9938568..9938758 455..265 955 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:17:35 has no hits.

IP04685.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:18:44 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9937090..9937422 455..787 100 <- Minus
chr2L 9937477..9937670 265..454 97 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:04 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 1..429 285..713 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:41 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 1..429 285..713 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:31:02 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 1..429 285..713 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:42 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 1..429 285..713 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:32:41 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 1..429 285..713 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:16 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 30..552 265..787 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:41 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 30..552 265..787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:31:02 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 33..555 265..787 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:42 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 30..552 265..787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:32:41 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
Apf-RA 33..555 265..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:44 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9938565..9938758 265..454 97 == Minus
2L 9938178..9938510 455..787 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:44 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9938565..9938758 265..454 97 == Minus
2L 9938178..9938510 455..787 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:18:44 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9938565..9938758 265..454 97 == Minus
2L 9938178..9938510 455..787 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:31:02 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9938178..9938510 455..787 100 <- Minus
arm_2L 9938565..9938758 265..454 97 == Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:56 Download gff for IP04685.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9938178..9938510 455..787 100 <- Minus
2L 9938565..9938758 265..454 97 == Minus

IP04685.hyp Sequence

Translation from 266 to 648

> IP04685.hyp
LIDSNNMEKAAGFVIFRRLCGEIQYLLLKASYGSFHWSSPKGHVDPGEDD
FTTALRETKEEAGKVRREGSDHIQGHSADPELSGARQAEDCYLLASGAAE
SLPGAHSLRGAHRPQVAAQGGGQAVRRL*

IP04685.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:11
Subject Length Description Subject Range Query Range Score Percent Strand
Apf-PA 142 CG31713-PA 1..57 7..63 304 100 Plus

IP04685.pep Sequence

Translation from 284 to 712

> IP04685.pep
MEKAAGFVIFRRLCGEIQYLLLKASYGSFHWSSPKGHVDPGEDDFTTALR
ETKEEAGYDEKDLIIYKDTPLTLNYQVQDKPKIVIYWLAELRNPCQEPIL
SEEHTDLKWLPKEEAKQCVGFKDNQVMIDKFHQMILDQNKPM*

IP04685.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14148-PA 144 GF14148-PA 1..141 1..141 701 92.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23993-PA 142 GG23993-PA 1..141 1..141 727 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10668-PA 150 GH10668-PA 3..141 2..140 622 82 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Apf-PA 142 CG31713-PA 1..142 1..142 767 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11018-PA 149 GI11018-PA 3..141 2..140 649 84.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19196-PA 109 GL19196-PA 18..105 53..140 361 76.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16415-PA 109 GA16415-PA 18..105 53..140 357 75 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12103-PA 107 GM12103-PA 15..107 50..142 440 88.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11976-PA 107 GD11976-PA 15..107 50..142 443 88.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18307-PA 113 GJ18307-PA 15..105 50..140 355 71.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14539-PA 143 GK14539-PA 1..142 1..140 634 83.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:42:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10149-PA 142 GE10149-PA 1..141 1..141 730 95.7 Plus