Clone IP04707 Report

Search the DGRC for IP04707

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:7
Vector:pOT2
Associated Gene/TranscriptCG14770-RA
Protein status:IP04707.pep: gold
Preliminary Size:456
Sequenced Size:735

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14770-RA 2009-01-21 est gleaning

Clone Sequence Records

IP04707.complete Sequence

735 bp assembled on 2009-02-19

GenBank Submission: BT060444.1

> IP04707.complete
AGCACTTCGCGTAACGGTCTACAGTTTCGAATATTTTTTTTGATTGTGCC
CCAGTGTGTGATTCAAAAGCAACCAGAAAACCATGCTCAAGTTGGCTATT
ACCTGCCTGGCCCTTCTGGCCGTTAGTGGAGCTCTGAAGATCCACGACTA
CCACCAGGGGCACGAGGAGTACGAGCACCACGACCATCATGAGCACCACG
AGCCGGAGCACCATGTGAAGTACGAGCCGGAGCACGAGGAGACGGAGCTG
CACCACGAGGTGGACCACAAGCACGCCACCTCGCACCAGAGCGTCAAGTT
CCACCACTACCATGCCGTGCCCGTCTACATCAAGAAGGAGGACCAGCACC
TGGTGAAAAAGCCTATCGAGATCGGCGGCACCAAGCAGAAGCTGAAGATC
CTGCACCCGAAGAGTGAGCACAACCACAACCACGGACTGGTGCTCGAAAA
CCACAGCGAGTCGCACCACGAGCACGGCCACTACGAGGAGCCGGTGCACC
ACTCGGAGCACTACGAGCACTACTCGCACCACGAGTAGGACTTGGACTAC
CAGAATCGGAAATGCCAAATGAGCTGTGGGGATTTCGTTAGCGTTTAAGG
ATTTGCTACGTTAATTTTCTTGTGTTAATAAAGCGTTGACCTAGAGTATA
GAGTACCACCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP04707.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14770-RA 1006 CG14770-RA 228..891 1..664 3320 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1263546..1264109 98..661 2805 99.8 Plus
chrX 22417052 chrX 1263211..1263307 1..97 485 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1369613..1370179 98..664 2835 100 Plus
X 23542271 X 1369278..1369374 1..97 485 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1377711..1378277 98..664 2835 100 Plus
X 23527363 X 1377376..1377472 1..97 485 100 Plus
Blast to na_te.dros performed 2019-03-16 15:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 850..959 334..440 111 57.3 Plus

IP04707.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:45:13 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1263211..1263307 1..97 100 -> Plus
chrX 1263546..1264109 98..661 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:01 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 1..456 83..538 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:23 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 1..456 83..538 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:18:01 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 1..456 83..538 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:52 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 1..456 83..538 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-19 18:47:16 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 1..456 83..538 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:23 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:18:01 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 1..661 1..661 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:52 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
CG14770-RA 30..690 1..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:13 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
X 1369278..1369374 1..97 100 -> Plus
X 1369613..1370176 98..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:13 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
X 1369278..1369374 1..97 100 -> Plus
X 1369613..1370176 98..661 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:45:13 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
X 1369278..1369374 1..97 100 -> Plus
X 1369613..1370176 98..661 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:18:01 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1263311..1263407 1..97 100 -> Plus
arm_X 1263646..1264209 98..661 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:09:58 Download gff for IP04707.complete
Subject Subject Range Query Range Percent Splice Strand
X 1377711..1378274 98..661 100   Plus
X 1377376..1377472 1..97 100 -> Plus

IP04707.hyp Sequence

Translation from 82 to 537

> IP04707.hyp
MLKLAITCLALLAVSGALKIHDYHQGHEEYEHHDHHEHHEPEHHVKYEPE
HEETELHHEVDHKHATSHQSVKFHHYHAVPVYIKKEDQHLVKKPIEIGGT
KQKLKILHPKSEHNHNHGLVLENHSESHHEHGHYEEPVHHSEHYEHYSHH
E*

IP04707.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14770-PA 151 CG14770-PA 1..151 1..151 868 100 Plus

IP04707.pep Sequence

Translation from 82 to 537

> IP04707.pep
MLKLAITCLALLAVSGALKIHDYHQGHEEYEHHDHHEHHEPEHHVKYEPE
HEETELHHEVDHKHATSHQSVKFHHYHAVPVYIKKEDQHLVKKPIEIGGT
KQKLKILHPKSEHNHNHGLVLENHSESHHEHGHYEEPVHHSEHYEHYSHH
E*

IP04707.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21011-PA 139 GF21011-PA 47..139 60..151 425 96.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12846-PA 145 GG12846-PA 1..145 1..151 675 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12727-PA 136 GH12727-PA 1..136 1..151 472 77.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14770-PA 151 CG14770-PA 1..151 1..151 868 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14980-PA 136 GI14980-PA 1..136 1..151 479 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14244-PA 441 GL14244-PA 308..425 17..138 405 86.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13234-PA 153 GA13234-PA 20..137 17..138 384 86.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19130-PA 151 GM19130-PA 1..151 1..151 714 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16552-PA 151 GD16552-PA 1..151 1..151 714 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15341-PA 138 GJ15341-PA 28..138 42..151 413 93.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16238-PA 145 GK16238-PA 1..145 1..151 443 78.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16682-PA 151 GE16682-PA 1..151 1..151 708 98 Plus