Clone IP04714 Report

Search the DGRC for IP04714

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:14
Vector:pOT2
Associated Gene/TranscriptCG14974-RA
Protein status:IP04714.pep: gold
Preliminary Size:415
Sequenced Size:474

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14974 2005-01-01 Successful iPCR screen
CG14974 2008-04-29 Release 5.5 accounting
CG14974 2008-08-15 Release 5.9 accounting
CG14974 2008-12-18 5.12 accounting

Clone Sequence Records

IP04714.complete Sequence

474 bp (474 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023664

> IP04714.complete
AAACAGTCTTTGGTCTCAATTTAACGAAATTCCAAAATGAATCCAAATTC
ACGGTGCCTCGCGCTGCTATTCGTTGCGTTATCCTTTCTAGCTCAGGGCT
TTTTCGACAGTTACAGAAGTCCAAAGGAGTCAGCCGGTCTGGCCACTCTC
TGTCAAGAAATTCAAAAGATCCAAGATGACTTTGTGCATCTGGCAGATAA
TTGCTCCATAGAGAAACTGACGGTGAACGACTCCCTGGAGTATCTGCAGA
TCAGTTGCCATGTGGATGATCTTCCAGAGGGCTACGAGCGGAGACTGAAA
CCCGTCGACTATGGCCGGAGTTTCTTCCTCAACCAACGGATGCCGAAGCC
TTTGAAGCGCCAGTGGAATTTCCGAGTGCCCACAGACGCCGTGAATGGAC
TCAGTCTGCTGACTTGATTGATTCGACTCCACTAGACTGATAAAGAAAAT
GTCAGAAATGAAAAAAAAAAAAAA

IP04714.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14974-RA 477 CG14974-RA 17..477 1..461 2305 100 Plus
CG14974.a 564 CG14974.a 87..544 1..461 2235 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3619791..3620049 460..202 1265 99.2 Minus
chr3L 24539361 chr3L 3620232..3620361 130..1 650 100 Minus
chr3L 24539361 chr3L 3620102..3620172 201..131 355 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3620432..3620691 461..202 1300 100 Minus
3L 28110227 3L 3620872..3621001 130..1 650 100 Minus
3L 28110227 3L 3620742..3620812 201..131 355 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3620432..3620691 461..202 1300 100 Minus
3L 28103327 3L 3620872..3621001 130..1 650 100 Minus
3L 28103327 3L 3620742..3620812 201..131 355 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:29:25 has no hits.

IP04714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:30:28 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3619791..3620049 202..460 99 <- Minus
chr3L 3620102..3620172 131..201 100 <- Minus
chr3L 3620232..3620361 1..130 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:11 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 1..381 37..417 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:24 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 1..381 37..417 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:46:26 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 1..381 37..417 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:15 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 1..381 37..417 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:13 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 1..381 37..417 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:32 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 17..476 1..460 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:24 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 17..476 1..460 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:46:26 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 32..491 1..460 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:15 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 1..460 1..460 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:13 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
CG14974-RA 32..491 1..460 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:28 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3620433..3620691 202..460 100 <- Minus
3L 3620742..3620812 131..201 100 <- Minus
3L 3620872..3621001 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:28 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3620433..3620691 202..460 100 <- Minus
3L 3620742..3620812 131..201 100 <- Minus
3L 3620872..3621001 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:28 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3620433..3620691 202..460 100 <- Minus
3L 3620742..3620812 131..201 100 <- Minus
3L 3620872..3621001 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:46:26 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3620433..3620691 202..460 100 <- Minus
arm_3L 3620742..3620812 131..201 100 <- Minus
arm_3L 3620872..3621001 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:41 Download gff for IP04714.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3620433..3620691 202..460 100 <- Minus
3L 3620742..3620812 131..201 100 <- Minus
3L 3620872..3621001 1..130 100   Minus

IP04714.hyp Sequence

Translation from 36 to 416

> IP04714.hyp
MNPNSRCLALLFVALSFLAQGFFDSYRSPKESAGLATLCQEIQKIQDDFV
HLADNCSIEKLTVNDSLEYLQISCHVDDLPEGYERRLKPVDYGRSFFLNQ
RMPKPLKRQWNFRVPTDAVNGLSLLT*

IP04714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14974-PA 126 CG14974-PA 1..126 1..126 663 100 Plus
CG14974-PC 125 CG14974-PC 1..125 1..126 647 99.2 Plus

IP04714.pep Sequence

Translation from 36 to 416

> IP04714.pep
MNPNSRCLALLFVALSFLAQGFFDSYRSPKESAGLATLCQEIQKIQDDFV
HLADNCSIEKLTVNDSLEYLQISCHVDDLPEGYERRLKPVDYGRSFFLNQ
RMPKPLKRQWNFRVPTDAVNGLSLLT*

IP04714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10263-PA 129 GF10263-PA 1..129 1..126 327 53.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14253-PA 127 GG14253-PA 1..127 1..126 504 78 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG14974-PA 126 CG14974-PA 1..126 1..126 663 100 Plus
CG14974-PC 125 CG14974-PC 1..125 1..126 647 99.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:47:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26718-PA 131 GL26718-PA 1..128 1..123 186 37.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13398-PA 131 GA13398-PA 1..128 1..123 180 36.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14047-PA 126 GM14047-PA 1..126 1..126 600 89.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:47:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13324-PA 126 GD13324-PA 1..126 1..126 618 92.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20370-PA 134 GK20370-PA 1..132 1..125 227 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20680-PA 127 GE20680-PA 1..127 1..126 515 79.5 Plus