IP04714.complete Sequence
474 bp (474 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023664
> IP04714.complete
AAACAGTCTTTGGTCTCAATTTAACGAAATTCCAAAATGAATCCAAATTC
ACGGTGCCTCGCGCTGCTATTCGTTGCGTTATCCTTTCTAGCTCAGGGCT
TTTTCGACAGTTACAGAAGTCCAAAGGAGTCAGCCGGTCTGGCCACTCTC
TGTCAAGAAATTCAAAAGATCCAAGATGACTTTGTGCATCTGGCAGATAA
TTGCTCCATAGAGAAACTGACGGTGAACGACTCCCTGGAGTATCTGCAGA
TCAGTTGCCATGTGGATGATCTTCCAGAGGGCTACGAGCGGAGACTGAAA
CCCGTCGACTATGGCCGGAGTTTCTTCCTCAACCAACGGATGCCGAAGCC
TTTGAAGCGCCAGTGGAATTTCCGAGTGCCCACAGACGCCGTGAATGGAC
TCAGTCTGCTGACTTGATTGATTCGACTCCACTAGACTGATAAAGAAAAT
GTCAGAAATGAAAAAAAAAAAAAA
IP04714.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:16:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14974-RA | 477 | CG14974-RA | 17..477 | 1..461 | 2305 | 100 | Plus |
CG14974.a | 564 | CG14974.a | 87..544 | 1..461 | 2235 | 99.3 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:29:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3619791..3620049 | 460..202 | 1265 | 99.2 | Minus |
chr3L | 24539361 | chr3L | 3620232..3620361 | 130..1 | 650 | 100 | Minus |
chr3L | 24539361 | chr3L | 3620102..3620172 | 201..131 | 355 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3620432..3620691 | 461..202 | 1300 | 100 | Minus |
3L | 28110227 | 3L | 3620872..3621001 | 130..1 | 650 | 100 | Minus |
3L | 28110227 | 3L | 3620742..3620812 | 201..131 | 355 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:09:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3620432..3620691 | 461..202 | 1300 | 100 | Minus |
3L | 28103327 | 3L | 3620872..3621001 | 130..1 | 650 | 100 | Minus |
3L | 28103327 | 3L | 3620742..3620812 | 201..131 | 355 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 15:29:25 has no hits.
IP04714.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:30:28 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3619791..3620049 | 202..460 | 99 | <- | Minus |
chr3L | 3620102..3620172 | 131..201 | 100 | <- | Minus |
chr3L | 3620232..3620361 | 1..130 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:11 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 1..381 | 37..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:24 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 1..381 | 37..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:46:26 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 1..381 | 37..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:15 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 1..381 | 37..417 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:13 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 1..381 | 37..417 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:32 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 17..476 | 1..460 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:24 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 17..476 | 1..460 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:46:26 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 32..491 | 1..460 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:15 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 1..460 | 1..460 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:13 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14974-RA | 32..491 | 1..460 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:28 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3620433..3620691 | 202..460 | 100 | <- | Minus |
3L | 3620742..3620812 | 131..201 | 100 | <- | Minus |
3L | 3620872..3621001 | 1..130 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:28 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3620433..3620691 | 202..460 | 100 | <- | Minus |
3L | 3620742..3620812 | 131..201 | 100 | <- | Minus |
3L | 3620872..3621001 | 1..130 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:28 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3620433..3620691 | 202..460 | 100 | <- | Minus |
3L | 3620742..3620812 | 131..201 | 100 | <- | Minus |
3L | 3620872..3621001 | 1..130 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:46:26 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3620433..3620691 | 202..460 | 100 | <- | Minus |
arm_3L | 3620742..3620812 | 131..201 | 100 | <- | Minus |
arm_3L | 3620872..3621001 | 1..130 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:41 Download gff for
IP04714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3620433..3620691 | 202..460 | 100 | <- | Minus |
3L | 3620742..3620812 | 131..201 | 100 | <- | Minus |
3L | 3620872..3621001 | 1..130 | 100 | | Minus |
IP04714.hyp Sequence
Translation from 36 to 416
> IP04714.hyp
MNPNSRCLALLFVALSFLAQGFFDSYRSPKESAGLATLCQEIQKIQDDFV
HLADNCSIEKLTVNDSLEYLQISCHVDDLPEGYERRLKPVDYGRSFFLNQ
RMPKPLKRQWNFRVPTDAVNGLSLLT*
IP04714.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14974-PA | 126 | CG14974-PA | 1..126 | 1..126 | 663 | 100 | Plus |
CG14974-PC | 125 | CG14974-PC | 1..125 | 1..126 | 647 | 99.2 | Plus |
IP04714.pep Sequence
Translation from 36 to 416
> IP04714.pep
MNPNSRCLALLFVALSFLAQGFFDSYRSPKESAGLATLCQEIQKIQDDFV
HLADNCSIEKLTVNDSLEYLQISCHVDDLPEGYERRLKPVDYGRSFFLNQ
RMPKPLKRQWNFRVPTDAVNGLSLLT*
IP04714.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:47:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10263-PA | 129 | GF10263-PA | 1..129 | 1..126 | 327 | 53.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:47:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14253-PA | 127 | GG14253-PA | 1..127 | 1..126 | 504 | 78 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14974-PA | 126 | CG14974-PA | 1..126 | 1..126 | 663 | 100 | Plus |
CG14974-PC | 125 | CG14974-PC | 1..125 | 1..126 | 647 | 99.2 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:47:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL26718-PA | 131 | GL26718-PA | 1..128 | 1..123 | 186 | 37.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:47:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13398-PA | 131 | GA13398-PA | 1..128 | 1..123 | 180 | 36.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:47:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14047-PA | 126 | GM14047-PA | 1..126 | 1..126 | 600 | 89.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:47:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13324-PA | 126 | GD13324-PA | 1..126 | 1..126 | 618 | 92.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:47:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK20370-PA | 134 | GK20370-PA | 1..132 | 1..125 | 227 | 43.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:47:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20680-PA | 127 | GE20680-PA | 1..127 | 1..126 | 515 | 79.5 | Plus |