Clone IP04735 Report

Search the DGRC for IP04735

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:35
Vector:pOT2
Associated Gene/TranscriptCG15403-RA
Protein status:IP04735.pep: gold
Preliminary Size:408
Sequenced Size:786

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15403 2005-01-01 Successful iPCR screen
CG15403 2008-04-29 Release 5.5 accounting
CG15403 2008-08-15 Release 5.9 accounting
CG15403 2008-12-18 5.12 accounting

Clone Sequence Records

IP04735.complete Sequence

786 bp (786 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022273

> IP04735.complete
CTACTCTTTATTTAGGAATTTCTACAAACTACGAAAAAATGTTCCCAAAG
TCGGGGAAGACATGTGCGCTTCTTGCAGCCCGTTTGCCTTATGGGTTTGC
GTTTAATCAACTCAAGACGATGTCACCTGTTCATCTCTTTCACTCGACTG
CCTTAATGCAAAACTACATAAGTGGAACAAGAAAACCAATTTCAATCAGA
GAAAAACGGGAATACAAATATTCATCTCAAGACATGAACTGGACGAAACA
TGGAGGATGCTTTAAGCAAAACTACAGTACCGAATCCGCCTCCACGGGGA
CCGCAACGACCTTAAAGATAACTAAAAGGGAACAACTGAAGCGGGCATTC
AAGGAGTATGGAGCAACCATTGTTGTCTTTCATGTGGTCATTTCCGTCAT
TTCTCTTGGAGGCTTTTATGCACTTGTTTCCAGTGGAATAAACCTGGTGC
CCGTACTGGAATACTTTGGAATGGGTTCATCGGCGGTTGCGGAGAAAGTT
GCCGCAGGAAGCACCTTTGTTGTGGCCTTTGCCGTTCATAAAATCTTTGC
GCCAGCCAGAATCAGCATCACATTGGGCACCACACCGTTTATCGTGAGGT
ATTTGCGATCCAAGGGACTTCTGAAGCCAAAAAGCACATAGTCACCTATT
TTAGGATACAAATTATTTCCTTGCTAGCTGTAACAATACCTTATTTCAAG
TTTTAATAGAAAATTACAAATTGAAAGCGTAGATCTGCAGGTCTAGAGCT
AATTCCATTTTGTAAAAAAAAAAAAAAAAAAAAAAA

IP04735.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15403-RA 770 CG15403-RA 8..770 1..763 3815 100 Plus
CG17508.e 1193 CG17508.e 681..933 319..571 320 75 Plus
CG17508.f 1247 CG17508.f 735..987 319..571 320 75 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3128395..3129157 1..763 3770 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3128727..3129490 1..764 3820 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3128727..3129490 1..764 3820 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:29:28 has no hits.

IP04735.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:30:18 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3128395..3129157 1..763 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:13 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 1..603 39..641 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:46 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 1..603 39..641 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:56:48 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 1..603 39..641 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:48 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 1..603 39..641 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:00:09 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 1..603 39..641 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:25 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 8..745 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:45 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 8..745 1..738 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:56:48 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 93..855 1..763 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:48 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 8..745 1..738 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:00:09 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
CG15403-RA 93..855 1..763 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:30:18 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3128727..3129489 1..763 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:30:18 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3128727..3129489 1..763 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:30:18 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3128727..3129489 1..763 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:56:48 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3128727..3129489 1..763 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:01 Download gff for IP04735.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3128727..3129489 1..763 100   Plus

IP04735.hyp Sequence

Translation from 2 to 640

> IP04735.hyp
TLYLGISTNYEKMFPKSGKTCALLAARLPYGFAFNQLKTMSPVHLFHSTA
LMQNYISGTRKPISIREKREYKYSSQDMNWTKHGGCFKQNYSTESASTGT
ATTLKITKREQLKRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVP
VLEYFGMGSSAVAEKVAAGSTFVVAFAVHKIFAPARISITLGTTPFIVRY
LRSKGLLKPKST*

IP04735.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG15403-PA 200 CG15403-PA 1..200 13..212 1016 100 Plus
CG17508-PA 321 CG17508-PA 164..321 65..212 421 60.1 Plus
CG14613-PB 241 CG14613-PB 91..212 90..212 161 31.2 Plus
CG14613-PA 241 CG14613-PA 91..212 90..212 161 31.2 Plus

IP04735.pep Sequence

Translation from 38 to 640

> IP04735.pep
MFPKSGKTCALLAARLPYGFAFNQLKTMSPVHLFHSTALMQNYISGTRKP
ISIREKREYKYSSQDMNWTKHGGCFKQNYSTESASTGTATTLKITKREQL
KRAFKEYGATIVVFHVVISVISLGGFYALVSSGINLVPVLEYFGMGSSAV
AEKVAAGSTFVVAFAVHKIFAPARISITLGTTPFIVRYLRSKGLLKPKST
*

IP04735.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19740-PA 67 GF19740-PA 1..61 136..196 213 63.9 Plus
Dana\GF21272-PA 238 GF21272-PA 104..206 99..200 153 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24922-PA 135 GG24922-PA 1..135 66..200 626 89.6 Plus
Dere\GG23170-PA 329 GG23170-PA 163..324 52..192 420 56.8 Plus
Dere\GG17514-PA 241 GG17514-PA 91..212 78..200 154 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13417-PA 333 GH13417-PA 224..329 93..198 420 70.8 Plus
Dgri\GH17805-PA 180 GH17805-PA 46..148 99..200 156 31.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15403-PA 200 CG15403-PA 1..200 1..200 1016 100 Plus
CG17508-PA 321 CG17508-PA 164..321 53..200 421 60.1 Plus
CG14613-PB 241 CG14613-PB 91..212 78..200 161 31.2 Plus
CG14613-PA 241 CG14613-PA 91..212 78..200 161 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17654-PA 320 GI17654-PA 145..316 52..198 420 52.9 Plus
Dmoj\GI15148-PA 281 GI15148-PA 148..250 99..200 153 32.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21148-PA 356 GL21148-PA 189..354 52..200 462 59 Plus
Dper\GL25441-PA 245 GL25441-PA 114..216 99..200 155 32.7 Plus
Dper\GL21614-PA 245 GL21614-PA 114..216 99..200 155 32.7 Plus
Dper\GL13428-PA 245 GL13428-PA 88..213 78..197 151 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29089-PA 356 GA29089-PA 189..354 52..200 470 59.6 Plus
Dpse\GA28259-PA 245 GA28259-PA 114..213 99..197 156 32.7 Plus
Dpse\GA28618-PA 244 GA28618-PA 114..216 99..200 154 32.7 Plus
Dpse\GA22887-PA 245 GA22887-PA 88..213 78..197 151 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18396-PA 135 GM18396-PA 1..135 66..200 686 98.5 Plus
Dsec\GM11723-PA 240 GM11723-PA 90..208 78..197 155 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23209-PA 134 GD23209-PA 1..134 66..200 668 97.8 Plus
Dsim\GD10376-PA 321 GD10376-PA 163..321 52..200 452 59.1 Plus
Dsim\GD15486-PA 240 GD15486-PA 90..208 78..197 153 31.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18221-PA 317 GJ18221-PA 164..317 52..200 440 59.7 Plus
Dvir\GJ19007-PA 263 GJ19007-PA 134..236 99..200 153 31.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15336-PA 346 GK15336-PA 166..342 52..198 448 53.1 Plus
Dwil\GK16185-PA 258 GK16185-PA 106..225 80..200 157 30.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18212-PA 198 GE18212-PA 1..198 1..200 869 85 Plus
Dyak\GE11308-PA 319 GE11308-PA 159..315 53..192 424 56.7 Plus
Dyak\GE15270-PA 241 GE15270-PA 91..212 78..200 153 31.2 Plus