BDGP Sequence Production Resources |
Search the DGRC for IP04757
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 47 |
Well: | 57 |
Vector: | pOT2 |
Associated Gene/Transcript | CG17217-RA |
Protein status: | IP04757.pep: gold |
Preliminary Size: | 483 |
Sequenced Size: | 564 |
Gene | Date | Evidence |
---|---|---|
CG17217 | 2005-01-01 | Successful iPCR screen |
CG17217 | 2008-04-29 | Release 5.5 accounting |
CG17217 | 2008-08-15 | Release 5.9 accounting |
CG17217 | 2008-12-18 | 5.12 accounting |
564 bp (564 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023662
> IP04757.complete TTTATACAAATCCCCAAAATTTCACATTATGAGACAGCAGCTGCTGGACG AGGAGTTCGAGAATCTGCGTCGCGTAGCGCTGGCCATATGCGAGAATCTC GGGAGACCAAAAGATCGGGAGATATGTCGAAGCACTCTAGAAGATCTGGC CAAGTTCCGCCAGGGATCGTCGATTAGGATTAAGGAGAATGTGCATAAGT TCCTGATGTTCTATCTAAAAGTTCTGAGATGGTCGTACAAGAATCAGCCA ACGGATCTATATCGCAAATGGTATGGACAAAACTTTGGCAAGGACCCAAA GTCTGCCCCATCGGCCGGCAATTCCGAGGATGAACAGCGTGTTTGGTTGG AGGAGGGCAAGTCCTTTTACGCCATGAAAACATTTGAAGATGGCTCCACA GTTGTTTACTCAGCGGTGGTTAAGGATGCGAGAGCTGGTTGGTCGGAAAA TGGTCTGAAAACTCTGATGGAAACGCAAGTGGGCTGCGCTTTGAATCGAA ATGAAAATTGAATTGTTTAATACTCTTAATATAGTATATATTTTCATAAA AAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 12169283..12169553 | 1..271 | 98 | -> | Plus |
chr2L | 12169611..12169886 | 272..547 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 44..590 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 80..626 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 1..483 | 29..511 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17217-RA | 80..626 | 1..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12170629..12170899 | 1..271 | 100 | -> | Plus |
2L | 12170957..12171232 | 272..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12170629..12170899 | 1..271 | 100 | -> | Plus |
2L | 12170957..12171232 | 272..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12170629..12170899 | 1..271 | 100 | -> | Plus |
2L | 12170957..12171232 | 272..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 12170629..12170899 | 1..271 | 100 | -> | Plus |
arm_2L | 12170957..12171232 | 272..547 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 12170957..12171232 | 272..547 | 100 | Plus | |
2L | 12170629..12170899 | 1..271 | 100 | -> | Plus |
Translation from 0 to 510
> IP04757.hyp LYKSPKFHIMRQQLLDEEFENLRRVALAICENLGRPKDREICRSTLEDLA KFRQGSSIRIKENVHKFLMFYLKVLRWSYKNQPTDLYRKWYGQNFGKDPK SAPSAGNSEDEQRVWLEEGKSFYAMKTFEDGSTVVYSAVVKDARAGWSEN GLKTLMETQVGCALNRNEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17217-PA | 160 | CG17217-PA | 1..160 | 10..169 | 845 | 100 | Plus |
Translation from 28 to 510
> IP04757.pep MRQQLLDEEFENLRRVALAICENLGRPKDREICRSTLEDLAKFRQGSSIR IKENVHKFLMFYLKVLRWSYKNQPTDLYRKWYGQNFGKDPKSAPSAGNSE DEQRVWLEEGKSFYAMKTFEDGSTVVYSAVVKDARAGWSENGLKTLMETQ VGCALNRNEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14190-PA | 160 | GF14190-PA | 2..159 | 1..159 | 571 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23774-PA | 154 | GG23774-PA | 1..153 | 1..159 | 702 | 82.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10562-PA | 157 | GH10562-PA | 14..154 | 4..148 | 416 | 53.8 | Plus |
Dgri\GH24945-PA | 159 | GH24945-PA | 14..156 | 4..148 | 403 | 53.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17217-PA | 160 | CG17217-PA | 1..160 | 1..160 | 845 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16840-PA | 163 | GI16840-PA | 11..149 | 4..147 | 391 | 55.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26001-PA | 185 | GL26001-PA | 54..184 | 4..146 | 369 | 49 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25228-PA | 218 | GA25228-PA | 58..135 | 4..81 | 225 | 51.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26755-PA | 158 | GM26755-PA | 1..155 | 1..155 | 782 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23826-PA | 159 | GD23826-PA | 1..159 | 1..160 | 799 | 94.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17199-PA | 170 | GJ17199-PA | 16..167 | 4..154 | 411 | 52.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15490-PA | 156 | GK15490-PA | 3..137 | 4..141 | 385 | 53.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18578-PA | 160 | GE18578-PA | 1..160 | 1..160 | 729 | 87.5 | Plus |