Clone IP04757 Report

Search the DGRC for IP04757

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:57
Vector:pOT2
Associated Gene/TranscriptCG17217-RA
Protein status:IP04757.pep: gold
Preliminary Size:483
Sequenced Size:564

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17217 2005-01-01 Successful iPCR screen
CG17217 2008-04-29 Release 5.5 accounting
CG17217 2008-08-15 Release 5.9 accounting
CG17217 2008-12-18 5.12 accounting

Clone Sequence Records

IP04757.complete Sequence

564 bp (564 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023662

> IP04757.complete
TTTATACAAATCCCCAAAATTTCACATTATGAGACAGCAGCTGCTGGACG
AGGAGTTCGAGAATCTGCGTCGCGTAGCGCTGGCCATATGCGAGAATCTC
GGGAGACCAAAAGATCGGGAGATATGTCGAAGCACTCTAGAAGATCTGGC
CAAGTTCCGCCAGGGATCGTCGATTAGGATTAAGGAGAATGTGCATAAGT
TCCTGATGTTCTATCTAAAAGTTCTGAGATGGTCGTACAAGAATCAGCCA
ACGGATCTATATCGCAAATGGTATGGACAAAACTTTGGCAAGGACCCAAA
GTCTGCCCCATCGGCCGGCAATTCCGAGGATGAACAGCGTGTTTGGTTGG
AGGAGGGCAAGTCCTTTTACGCCATGAAAACATTTGAAGATGGCTCCACA
GTTGTTTACTCAGCGGTGGTTAAGGATGCGAGAGCTGGTTGGTCGGAAAA
TGGTCTGAAAACTCTGATGGAAACGCAAGTGGGCTGCGCTTTGAATCGAA
ATGAAAATTGAATTGTTTAATACTCTTAATATAGTATATATTTTCATAAA
AAAAAAAAAAAAAA

IP04757.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17217-RA 639 CG17217-RA 80..627 1..548 2740 100 Plus
CG6583-RA 1119 CG6583-RA 1043..1119 548..472 385 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:33:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12169610..12169886 271..547 1340 98.9 Plus
chr2L 23010047 chr2L 12169283..12169553 1..271 1310 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12170956..12171233 271..548 1390 100 Plus
2L 23513712 2L 12170629..12170899 1..271 1355 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12170956..12171233 271..548 1390 100 Plus
2L 23513712 2L 12170629..12170899 1..271 1355 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:33:14 has no hits.

IP04757.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:33:58 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12169283..12169553 1..271 98 -> Plus
chr2L 12169611..12169886 272..547 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:16 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:45 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:57:27 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:12 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:01:42 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:11 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:45 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 44..590 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:57:27 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 80..626 1..547 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:12 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 1..483 29..511 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:01:42 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
CG17217-RA 80..626 1..547 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:58 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12170629..12170899 1..271 100 -> Plus
2L 12170957..12171232 272..547 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:58 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12170629..12170899 1..271 100 -> Plus
2L 12170957..12171232 272..547 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:58 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12170629..12170899 1..271 100 -> Plus
2L 12170957..12171232 272..547 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:57:27 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12170629..12170899 1..271 100 -> Plus
arm_2L 12170957..12171232 272..547 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:45 Download gff for IP04757.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12170957..12171232 272..547 100   Plus
2L 12170629..12170899 1..271 100 -> Plus

IP04757.hyp Sequence

Translation from 0 to 510

> IP04757.hyp
LYKSPKFHIMRQQLLDEEFENLRRVALAICENLGRPKDREICRSTLEDLA
KFRQGSSIRIKENVHKFLMFYLKVLRWSYKNQPTDLYRKWYGQNFGKDPK
SAPSAGNSEDEQRVWLEEGKSFYAMKTFEDGSTVVYSAVVKDARAGWSEN
GLKTLMETQVGCALNRNEN*

IP04757.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG17217-PA 160 CG17217-PA 1..160 10..169 845 100 Plus

IP04757.pep Sequence

Translation from 28 to 510

> IP04757.pep
MRQQLLDEEFENLRRVALAICENLGRPKDREICRSTLEDLAKFRQGSSIR
IKENVHKFLMFYLKVLRWSYKNQPTDLYRKWYGQNFGKDPKSAPSAGNSE
DEQRVWLEEGKSFYAMKTFEDGSTVVYSAVVKDARAGWSENGLKTLMETQ
VGCALNRNEN*

IP04757.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14190-PA 160 GF14190-PA 2..159 1..159 571 62.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23774-PA 154 GG23774-PA 1..153 1..159 702 82.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10562-PA 157 GH10562-PA 14..154 4..148 416 53.8 Plus
Dgri\GH24945-PA 159 GH24945-PA 14..156 4..148 403 53.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG17217-PA 160 CG17217-PA 1..160 1..160 845 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16840-PA 163 GI16840-PA 11..149 4..147 391 55.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26001-PA 185 GL26001-PA 54..184 4..146 369 49 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25228-PA 218 GA25228-PA 58..135 4..81 225 51.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26755-PA 158 GM26755-PA 1..155 1..155 782 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23826-PA 159 GD23826-PA 1..159 1..160 799 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17199-PA 170 GJ17199-PA 16..167 4..154 411 52.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15490-PA 156 GK15490-PA 3..137 4..141 385 53.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18578-PA 160 GE18578-PA 1..160 1..160 729 87.5 Plus