Clone IP04765 Report

Search the DGRC for IP04765

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:65
Vector:pOT2
Associated Gene/TranscriptCG18371-RA
Protein status:IP04765.pep: gold
Preliminary Size:489
Sequenced Size:441

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18371 2005-01-01 Successful iPCR screen
CG18371 2008-04-29 Release 5.5 accounting
CG18371 2008-08-15 Release 5.9 accounting
CG18371 2008-12-18 5.12 accounting

Clone Sequence Records

IP04765.complete Sequence

441 bp (441 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022270.1

> IP04765.complete
TCTCTCTCTCGATCGACAATAAGTTGGAGTTATTTCTAGAAAAAACGAAG
CATATTGAAGATGATGCAGCCAGCGGAACAGATCTTCTCCTGCGGATTCG
AACTCTTCGGGCGAGTACAGGGTGTGTGTTTGCGGAAGCAGACACGAGAT
CTGGCCACAATGAACCAGGTGCGCGGGTGGGTGATGAACACGGACGAGGG
CACGGTGAAGGGACAGCTGGAGGGCACACTGCCCAAGGTCAACGTGCTGA
AGTTCTGGCTACTGAATATCGGCAGTCCGCGCTCGATTATCGAGCGGGCG
GAATTCACGCCCACCAAGGAGATCACTTCGCACAACTTTAGCCGATTCTC
GATTCGCTACCACAATGTGGCAGCAACGAAAAAGGCCATTTAATAAAGAA
TTTAGACTTGTAGTCTACTACCGAAAAAAAAAAAAAAAAAA

IP04765.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-RA 489 CG18371-RA 57..483 1..427 2135 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9916014..9916436 1..423 2085 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14028674..14029100 1..427 2135 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14029873..14030299 1..427 2135 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:31:30 has no hits.

IP04765.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:26 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9916014..9916436 1..423 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:17 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 1..333 61..393 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:45 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 1..333 61..393 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:25 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 1..333 61..393 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:46 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 1..333 61..393 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:08 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 1..333 61..393 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:55 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 57..479 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:45 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 57..479 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:25 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 55..477 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:47 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 57..479 1..423 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:08 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 55..477 1..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:26 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14028674..14029096 1..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:26 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14028674..14029096 1..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:26 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14028674..14029096 1..423 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:25 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9916179..9916601 1..423 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:01:44 Download gff for IP04765.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14029873..14030295 1..423 100   Plus

IP04765.hyp Sequence

Translation from 2 to 340

> IP04765.hyp
SLSIDNKLELFLEKTKHIEDDAASGTDLLLRIRTLRASTGCVFAEADTRS
GHNEPGARVGDEHGRGHGEGTAGGHTAQGQRAEVLATEYRQSALDYRAGG
IHAHQGDHFAQL*
Sequence IP04765.hyp has no blast hits.

IP04765.pep Sequence

Translation from 60 to 392

> IP04765.pep
MMQPAEQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVK
GQLEGTLPKVNVLKFWLLNIGSPRSIIERAEFTPTKEITSHNFSRFSIRY
HNVAATKKAI*

IP04765.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12022-PA 108 GF12022-PA 1..105 1..105 469 82.9 Plus
Dana\GF18541-PA 102 GF18541-PA 7..101 5..99 315 61.1 Plus
Dana\GF14085-PA 119 GF14085-PA 24..118 5..99 273 56.8 Plus
Dana\GF19668-PA 116 GF19668-PA 3..97 5..99 227 45.3 Plus
Dana\GF16871-PA 150 GF16871-PA 55..147 6..98 204 44.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20418-PA 107 GG20418-PA 1..106 2..107 534 93.4 Plus
Dere\GG16952-PA 102 GG16952-PA 7..101 5..99 263 52.6 Plus
Dere\GG10375-PA 124 GG10375-PA 31..123 7..99 256 52.7 Plus
Dere\GG23897-PA 119 GG23897-PA 3..97 5..99 212 42.1 Plus
Dere\GG24762-PA 149 GG24762-PA 54..146 6..98 190 40.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22670-PA 111 GH22670-PA 4..104 1..101 357 64.4 Plus
Dgri\GH18239-PA 96 GH18239-PA 4..95 8..99 259 55.4 Plus
Dgri\GH11331-PA 99 GH11331-PA 1..98 2..99 240 45.9 Plus
Dgri\GH11746-PA 124 GH11746-PA 29..123 5..99 233 45.3 Plus
Dgri\GH13536-PA 101 GH13536-PA 8..101 7..100 170 36.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-PA 110 CG18371-PA 1..110 1..110 574 100 Plus
CG34161-PC 125 CG34161-PC 32..124 7..99 250 51.6 Plus
CG34161-PA 125 CG34161-PA 32..124 7..99 250 51.6 Plus
CG34161-PB 120 CG34161-PB 32..119 7..99 231 50.5 Plus
Acyp2-PB 102 CG18505-PB 7..102 5..100 222 46.9 Plus
Acyp2-PA 102 CG18505-PA 7..102 5..100 222 46.9 Plus
Acyp-PB 120 CG16870-PB 6..97 8..99 203 43.5 Plus
Acyp-PA 120 CG16870-PA 6..97 8..99 203 43.5 Plus
CG11052-PD 149 CG11052-PD 54..146 6..98 197 43 Plus
CG11052-PC 149 CG11052-PC 54..146 6..98 197 43 Plus
CG11052-PB 149 CG11052-PB 54..146 6..98 197 43 Plus
CG11052-PA 149 CG11052-PA 54..146 6..98 197 43 Plus
CG14022-PB 101 CG14022-PB 14..101 13..100 162 36.4 Plus
CG14022-PA 101 CG14022-PA 14..101 13..100 162 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:53:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21180-PA 110 GI21180-PA 1..101 1..101 374 66.3 Plus
Dmoj\GI10195-PA 96 GI10195-PA 3..94 7..98 252 51.1 Plus
Dmoj\GI17837-PA 99 GI17837-PA 1..98 2..99 251 51 Plus
Dmoj\GI22288-PA 120 GI22288-PA 4..95 8..99 214 45.7 Plus
Dmoj\GI10542-PA 101 GI10542-PA 8..101 7..100 164 34 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16721-PA 110 GL16721-PA 1..101 1..101 457 82.2 Plus
Dper\GL22235-PA 102 GL22235-PA 7..101 5..99 280 57.9 Plus
Dper\GL26404-PA 132 GL26404-PA 22..116 5..99 240 50.5 Plus
Dper\GL21249-PA 116 GL21249-PA 4..104 6..106 239 43.6 Plus
Dper\GL22340-PA 143 GL22340-PA 41..141 3..99 186 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14909-PA 110 GA14909-PA 1..101 1..101 450 81.2 Plus
Dpse\GA27428-PA 102 GA27428-PA 7..101 5..99 280 57.9 Plus
Dpse\GA28850-PA 117 GA28850-PA 22..116 5..99 240 50.5 Plus
Dpse\GA28779-PA 116 GA28779-PA 4..104 6..106 239 43.6 Plus
Dpse\GA12705-PA 102 GA12705-PA 9..102 7..100 167 34 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21504-PA 110 GM21504-PA 1..110 1..110 560 94.5 Plus
Dsec\GM11586-PA 124 GM11586-PA 31..123 7..99 249 50.5 Plus
Dsec\GM24259-PA 102 GM24259-PA 7..101 5..99 248 50.5 Plus
Dsec\GM15374-PA 120 GM15374-PA 4..97 6..99 214 42.6 Plus
Dsec\GM10438-PA 149 GM10438-PA 54..146 6..98 190 41.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10999-PA 110 GD10999-PA 1..110 1..110 560 94.5 Plus
Dsim\GD22242-PA 124 GD22242-PA 30..123 6..99 249 50 Plus
Dsim\Acyp-PA 120 GD23938-PA 4..97 6..99 214 42.6 Plus
Dsim\GD19440-PA 149 GD19440-PA 54..146 6..98 190 41.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21038-PA 111 GJ21038-PA 1..101 1..101 386 70.3 Plus
Dvir\GJ17330-PA 99 GJ17330-PA 1..98 2..99 249 50 Plus
Dvir\GJ23483-PA 96 GJ23483-PA 2..95 6..99 225 51.1 Plus
Dvir\GJ24080-PA 122 GJ24080-PA 4..95 8..99 222 47.8 Plus
Dvir\GJ21758-PA 101 GJ21758-PA 8..101 7..100 172 37.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19418-PA 107 GK19418-PA 1..102 1..102 438 76.5 Plus
Dwil\GK12388-PA 99 GK12388-PA 1..98 2..99 252 46.9 Plus
Dwil\GK15522-PA 126 GK15522-PA 32..125 6..99 252 52.1 Plus
Dwil\GK14028-PA 139 GK14028-PA 46..137 8..99 186 42.4 Plus
Dwil\GK18433-PA 101 GK18433-PA 8..101 7..100 148 30.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12579-PA 110 GE12579-PA 1..110 1..110 569 95.5 Plus
Dyak\GE24338-PA 102 GE24338-PA 7..101 5..99 266 52.6 Plus
Dyak\GE13517-PA 124 GE13517-PA 31..123 7..99 254 51.6 Plus
Dyak\GE19011-PA 120 GE19011-PA 3..97 5..99 216 43.2 Plus
Dyak\GE25751-PA 149 GE25751-PA 54..146 6..98 190 43 Plus