Clone IP04766 Report

Search the DGRC for IP04766

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:66
Vector:pOT2
Associated Gene/TranscriptAcyp2-RA
Protein status:IP04766.pep: gold
Preliminary Size:475
Sequenced Size:580

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18505 2005-01-01 Successful iPCR screen
Acyp2 2008-04-29 Release 5.5 accounting
Acyp2 2008-08-15 Release 5.9 accounting
Acyp2 2008-12-18 5.12 accounting

Clone Sequence Records

IP04766.complete Sequence

580 bp (580 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024404

> IP04766.complete
TCGCCCTGGCTACGATAACTATGTTACAATTTAATAATAATTCTATTTTG
GTTGTCAACATTCAGTTTTTGCTAGCTCTATTTAGAAATTTGAGTGCTGC
AAGGAATCTAAGTGGCATCAGAAATCTGATCACGACTACATAATGGCGGG
ATCTGGAGTTGCCAAGCAGATATTTGCCCTCGATTTCGAGATCTTTGGAC
GAGTGCAAGGTGTGTTCTTCCGCAAACACACGTCGCATGAGGCTAAAAGA
TTGGGAGTTAGGGGCTGGTGCATGAATACCCGGGATGGGACCGTCAAGGG
ACAACTGGAGGCTCCTATGATGAATTTAATGGAAATGAAACATTGGCTGG
AGAACAACCGAATTCCCAACGCTAAGGTCTCAAAGGCTGAATTTTCGCAA
ATCCAGGAAATCGAGGACTATACGTTCACTTCCTTTGACATAAAACATTA
AAAACGAATTATTAGCTCTTTCGTTGTCCATCCAATTCCGAAACAAAGTC
TAAATAAATTACCAGGGCTGCAACTTGCGTAAGCAGGCAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP04766.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-RA 745 Acyp2-RA 1..539 1..539 2695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11617294..11617504 1..211 1055 100 Plus
chr3R 27901430 chr3R 11617811..11618012 337..538 995 99.5 Plus
chr3R 27901430 chr3R 11617643..11617753 227..337 555 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15792693..15792903 1..211 1055 100 Plus
3R 32079331 3R 15793210..15793412 337..539 1015 100 Plus
3R 32079331 3R 15793042..15793152 227..337 555 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15533524..15533734 1..211 1055 100 Plus
3R 31820162 3R 15534041..15534243 337..539 1015 100 Plus
3R 31820162 3R 15533873..15533983 227..337 555 100 Plus
Blast to na_te.dros performed 2019-03-16 15:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 5470..5541 318..392 106 64 Plus

IP04766.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:32:37 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11617811..11618012 337..538 99   Plus
chr3R 11617294..11617502 1..209 100 -> Plus
chr3R 11617558..11617574 210..226 100 -> Plus
chr3R 11617643..11617752 227..336 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:18 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..309 143..451 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:37:31 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..309 143..451 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:47:42 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..309 143..451 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:13:46 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..309 143..451 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:29 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..309 143..451 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:41:24 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..475 47..521 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:37:31 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..475 47..521 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:47:42 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 6..543 1..538 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:13:46 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 1..475 47..521 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:29 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
Acyp2-RA 6..543 1..538 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:37 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15792693..15792901 1..209 100 -> Plus
3R 15792957..15792973 210..226 100 -> Plus
3R 15793042..15793151 227..336 100 -> Plus
3R 15793210..15793411 337..538 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:37 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15792693..15792901 1..209 100 -> Plus
3R 15792957..15792973 210..226 100 -> Plus
3R 15793042..15793151 227..336 100 -> Plus
3R 15793210..15793411 337..538 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:32:37 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15792693..15792901 1..209 100 -> Plus
3R 15792957..15792973 210..226 100 -> Plus
3R 15793042..15793151 227..336 100 -> Plus
3R 15793210..15793411 337..538 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:47:42 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11618932..11619133 337..538 100   Plus
arm_3R 11618415..11618623 1..209 100 -> Plus
arm_3R 11618679..11618695 210..226 100 -> Plus
arm_3R 11618764..11618873 227..336 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:09 Download gff for IP04766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15533524..15533732 1..209 100 -> Plus
3R 15533788..15533804 210..226 100 -> Plus
3R 15533873..15533982 227..336 100 -> Plus
3R 15534041..15534242 337..538 100   Plus

IP04766.hyp Sequence

Translation from 142 to 450

> IP04766.hyp
MAGSGVAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGT
VKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDI
KH*

IP04766.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-PB 102 CG18505-PB 1..102 1..102 540 100 Plus
Acyp2-PA 102 CG18505-PA 1..102 1..102 540 100 Plus
CG34161-PC 125 CG34161-PC 32..124 9..101 245 47.3 Plus
CG34161-PA 125 CG34161-PA 32..124 9..101 245 47.3 Plus
CG11052-PD 149 CG11052-PD 56..146 10..100 233 44 Plus

IP04766.pep Sequence

Translation from 142 to 450

> IP04766.pep
MAGSGVAKQIFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGT
VKGQLEAPMMNLMEMKHWLENNRIPNAKVSKAEFSQIQEIEDYTFTSFDI
KH*

IP04766.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18541-PA 102 GF18541-PA 1..102 1..102 350 58.8 Plus
Dana\GF14085-PA 119 GF14085-PA 24..119 7..102 261 50 Plus
Dana\GF12022-PA 108 GF12022-PA 5..100 7..102 242 51 Plus
Dana\GF19668-PA 116 GF19668-PA 2..97 6..101 237 42.7 Plus
Dana\GF16871-PA 150 GF16871-PA 57..147 10..100 208 40.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16952-PA 102 GG16952-PA 1..102 1..102 416 74.5 Plus
Dere\GG10375-PA 124 GG10375-PA 26..123 4..101 246 45.9 Plus
Dere\GG20418-PA 107 GG20418-PA 4..99 7..102 230 47.9 Plus
Dere\GG24762-PA 149 GG24762-PA 56..146 10..100 226 42.9 Plus
Dere\GG23897-PA 119 GG23897-PA 2..97 6..101 218 42.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18239-PA 96 GH18239-PA 4..96 10..102 309 57 Plus
Dgri\GH11331-PA 99 GH11331-PA 2..98 5..101 269 49.5 Plus
Dgri\GH11746-PA 124 GH11746-PA 27..124 5..102 267 49 Plus
Dgri\GH15191-PA 141 GH15191-PA 45..135 10..100 226 44 Plus
Dgri\GH22670-PA 111 GH22670-PA 10..103 9..102 202 45.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Acyp2-PB 102 CG18505-PB 1..102 1..102 540 100 Plus
Acyp2-PA 102 CG18505-PA 1..102 1..102 540 100 Plus
CG34161-PC 125 CG34161-PC 32..124 9..101 245 47.3 Plus
CG34161-PA 125 CG34161-PA 32..124 9..101 245 47.3 Plus
CG11052-PD 149 CG11052-PD 56..146 10..100 233 44 Plus
CG11052-PC 149 CG11052-PC 56..146 10..100 233 44 Plus
CG11052-PB 149 CG11052-PB 56..146 10..100 233 44 Plus
CG11052-PA 149 CG11052-PA 56..146 10..100 233 44 Plus
Acyp-PB 120 CG16870-PB 6..97 10..101 226 45.7 Plus
Acyp-PA 120 CG16870-PA 6..97 10..101 226 45.7 Plus
CG18371-PA 110 CG18371-PA 5..100 7..102 222 46.9 Plus
CG34161-PB 120 CG34161-PB 32..119 9..101 216 45.2 Plus
CG14022-PB 101 CG14022-PB 9..100 10..101 143 27.2 Plus
CG14022-PA 101 CG14022-PA 9..100 10..101 143 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10195-PA 96 GI10195-PA 3..94 9..100 300 55.4 Plus
Dmoj\GI22288-PA 120 GI22288-PA 4..95 10..101 264 51.1 Plus
Dmoj\GI17837-PA 99 GI17837-PA 5..98 8..101 257 50 Plus
Dmoj\GI21180-PA 110 GI21180-PA 5..100 7..102 190 42.7 Plus
Dmoj\GI10542-PA 101 GI10542-PA 7..100 8..101 150 26.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22235-PA 102 GL22235-PA 1..101 1..101 363 63.4 Plus
Dper\GL26404-PA 132 GL26404-PA 22..116 7..101 248 48.4 Plus
Dper\GL21249-PA 116 GL21249-PA 6..97 10..101 237 43.5 Plus
Dper\GL16721-PA 110 GL16721-PA 5..100 7..102 231 49 Plus
Dper\GL22340-PA 143 GL22340-PA 42..142 2..102 204 38.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27428-PA 102 GA27428-PA 1..101 1..101 363 63.4 Plus
Dpse\GA28850-PA 117 GA28850-PA 22..116 7..101 251 49.5 Plus
Dpse\GA28779-PA 116 GA28779-PA 6..97 10..101 237 43.5 Plus
Dpse\GA14909-PA 110 GA14909-PA 5..100 7..102 230 49 Plus
Dpse\GA12705-PA 102 GA12705-PA 8..101 8..101 152 26.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24259-PA 102 GM24259-PA 1..102 1..102 440 78.4 Plus
Dsec\GM11586-PA 124 GM11586-PA 31..123 9..101 241 47.3 Plus
Dsec\GM21504-PA 110 GM21504-PA 5..100 7..102 233 47.9 Plus
Dsec\GM10438-PA 149 GM10438-PA 56..146 10..100 226 44 Plus
Dsec\GM15374-PA 120 GM15374-PA 4..97 8..101 224 44.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22242-PA 124 GD22242-PA 31..123 9..101 242 47.3 Plus
Dsim\GD10999-PA 110 GD10999-PA 5..100 7..102 233 47.9 Plus
Dsim\GD19440-PA 149 GD19440-PA 56..146 10..100 226 44 Plus
Dsim\Acyp-PA 120 GD23938-PA 4..97 8..101 224 44.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23483-PA 96 GJ23483-PA 4..95 10..101 278 55.4 Plus
Dvir\GJ24080-PA 122 GJ24080-PA 4..95 10..101 265 50 Plus
Dvir\GJ17330-PA 99 GJ17330-PA 2..98 5..101 264 49.5 Plus
Dvir\GJ21038-PA 111 GJ21038-PA 7..100 9..102 200 45.7 Plus
Dvir\GJ21758-PA 101 GJ21758-PA 7..100 8..101 154 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15522-PA 126 GK15522-PA 31..125 7..101 262 49.5 Plus
Dwil\GK12388-PA 99 GK12388-PA 4..98 7..101 257 46.3 Plus
Dwil\GK19418-PA 107 GK19418-PA 5..100 7..102 218 45.8 Plus
Dwil\GK14028-PA 139 GK14028-PA 44..137 8..101 202 40.4 Plus
Dwil\GK18433-PA 101 GK18433-PA 7..100 8..101 159 27.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24338-PA 102 GE24338-PA 1..102 1..102 421 75.5 Plus
Dyak\GE13517-PA 124 GE13517-PA 31..123 9..101 244 47.3 Plus
Dyak\GE12579-PA 110 GE12579-PA 5..100 7..102 236 49 Plus
Dyak\GE19011-PA 120 GE19011-PA 2..97 6..101 226 44.8 Plus
Dyak\GE25751-PA 149 GE25751-PA 56..146 10..100 222 42.9 Plus