Clone IP04776 Report

Search the DGRC for IP04776

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:76
Vector:pOT2
Associated Gene/TranscriptCG31007-RA
Protein status:IP04776.pep: gold
Preliminary Size:489
Sequenced Size:838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31007 2005-01-01 Successful iPCR screen
CG31007 2008-04-29 Release 5.5 accounting
CG31007 2008-08-15 Release 5.9 accounting
CG31007 2008-12-18 5.12 accounting

Clone Sequence Records

IP04776.complete Sequence

838 bp (838 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022266

> IP04776.complete
TTTCAGCAAGTCAGCCTTCACATTTGCCGTCTGCTCATTTTTGAAAGGAT
ATGCCCCGCCAACGTTCGGAAGGGCCGCGATCCACAGGATCTATGCGGCG
CCAAAGCAGCCGGAGCAGCCATGTCTTCGCCACAAAGCCGTCTCGTGGGA
GCAGCAAGGATCTGCCGGCTGTGCAGCAGCCCAAGAAGGAATCCCTGCCA
GCTGCAGCTCCTGCTGCCTCGGCAGCCACCTCCACAGAGACAAAAGGTCC
TAGCACAGCAGATAGGTTCAAGGACATGGCCACCACGGCGGCTGGCGTGG
CAGCAGGATCAGCTGTGGGCCACGCTGTGGGCGCAGGACTCACGGGAATG
TTCCAGGGACGTGGTCAGGCAGCCCCGGCCAAGGAGCAGCCTCAACAGGA
GGGATCCTTGGCAGCTTCAGCTTCGCAATCAGTACCGAAACCTCAACTAG
TGGAGGATGGTCCCTGCGCCTTCGAGCTGAGGCAGTTCCTCAAGTGCACC
GAGGACAACAGCAGTGATCTCTCCGTTTGCAAGGAGTTTAACGAGGCAAT
GCAGCAGTGTCGGCGGCGCTATAATGTCTGAGATGCTAGGATGGTGACCT
CATCCAGATTACAGAAGCAAATCAATGAGATTAATCTAAAGCATACATAT
ATGTACATATGGTATTTAATTTGCAGTTGGCTACCCAAAAATAGACATTT
TTTCGGAATAAAATGAAAATTTTTCGCCTTGTCAGACTGGTAGAAACATC
CTTTTTGATCGGCGATCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP04776.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31007-RA 723 CG31007-RA 1..723 11..733 3615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26814212..26814974 763..1 3650 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30991691..30992467 777..1 3855 99.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30732522..30733298 777..1 3855 99.7 Minus
Blast to na_te.dros performed on 2019-03-16 20:08:39 has no hits.

IP04776.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:09:28 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26814207..26814974 1..768 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:20 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..531 51..581 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:27 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..531 51..581 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:52:12 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..531 51..581 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:30 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..531 51..581 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:38 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..531 51..581 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:20:56 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..723 11..733 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:26 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..723 11..733 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:52:12 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..758 11..768 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:30 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..723 11..733 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:38 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
CG31007-RA 1..758 11..768 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:28 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30991700..30992467 1..768 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:28 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30991700..30992467 1..768 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:28 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30991700..30992467 1..768 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:52:12 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26817422..26818189 1..768 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:41 Download gff for IP04776.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30732531..30733298 1..768 100   Minus

IP04776.pep Sequence

Translation from 50 to 580

> IP04776.pep
MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLP
AAAPAASAATSTETKGPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGM
FQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQFLKCT
EDNSSDLSVCKEFNEAMQQCRRRYNV*

IP04776.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23297-PA 182 GF23297-PA 1..182 1..176 438 64.6 Plus
Dana\GF23298-PA 119 GF23298-PA 14..119 34..176 228 45.1 Plus
Dana\GF22321-PA 161 GF22321-PA 52..160 67..176 194 38.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11896-PA 176 GG11896-PA 1..176 1..176 661 92 Plus
Dere\GG11897-PA 114 GG11897-PA 32..114 73..176 242 52.9 Plus
Dere\GG19099-PA 169 GG19099-PA 61..168 67..176 191 41.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14350-PA 173 GH14350-PA 1..173 1..176 335 50.3 Plus
Dgri\GH12294-PA 160 GH12294-PA 56..159 73..176 197 41.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31007-PA 176 CG31007-PA 1..176 1..176 894 100 Plus
CG31008-PA 114 CG31008-PA 32..114 73..176 255 51 Plus
Chchd2-PA 170 CG5010-PA 42..169 48..176 232 37.4 Plus
Chchd2-PB 122 CG5010-PB 13..121 67..176 215 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10444-PA 168 GI10444-PA 1..168 1..176 334 50.8 Plus
Dmoj\GI15541-PA 166 GI15541-PA 56..165 67..176 195 39.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13971-PA 188 GL13971-PA 1..188 1..176 293 52.9 Plus
Dper\GL15878-PA 161 GL15878-PA 54..160 67..176 188 38.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15932-PA 184 GA15932-PA 1..184 1..176 297 53.5 Plus
Dpse\GA18592-PA 161 GA18592-PA 54..160 67..176 187 38.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12113-PA 176 GM12113-PA 1..176 1..176 875 96 Plus
Dsec\GM12115-PA 114 GM12115-PA 18..114 49..176 184 43 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16686-PA 174 GD16686-PA 1..174 1..176 868 96.6 Plus
Dsim\GD17330-PA 113 GD17330-PA 11..112 74..176 184 37.9 Plus
Dsim\GD16697-PA 114 GD16697-PA 18..114 49..176 184 43 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10660-PA 158 GJ10660-PA 32..158 34..176 337 61.5 Plus
Dvir\GJ14883-PA 167 GJ14883-PA 57..166 67..176 197 40.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14164-PA 149 GK14164-PA 1..149 1..176 390 52.5 Plus
Dwil\GK19777-PA 162 GK19777-PA 59..161 73..176 192 40.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23343-PA 171 GE23343-PA 1..171 1..176 573 85.9 Plus
Dyak\GE23344-PA 114 GE23344-PA 27..114 68..176 247 54.1 Plus
Dyak\GE17645-PA 169 GE17645-PA 61..168 67..176 191 41.6 Plus

IP04776.hyp Sequence

Translation from 50 to 580

> IP04776.hyp
MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLP
AAAPAASAATSTETKGPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGM
FQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQFLKCT
EDNSSDLSVCKEFNEAMQQCRRRYNV*

IP04776.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG31007-PA 176 CG31007-PA 1..176 1..176 894 100 Plus
CG31008-PA 114 CG31008-PA 32..114 73..176 255 51 Plus
CG5010-PA 170 CG5010-PA 42..169 48..176 232 37.4 Plus
CG5010-PB 122 CG5010-PB 13..121 67..176 215 40 Plus