Clone IP04788 Report

Search the DGRC for IP04788

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:88
Vector:pOT2
Associated Gene/TranscriptCG31807-RA
Protein status:IP04788.pep: gold
Preliminary Size:468
Sequenced Size:730

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31807 2005-01-01 Successful iPCR screen
CG31807 2008-04-29 Release 5.5 accounting
CG31807 2008-08-15 Release 5.9 accounting
CG31807 2008-12-18 5.12 accounting

Clone Sequence Records

IP04788.complete Sequence

730 bp (730 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023659

> IP04788.complete
AATTCGTTCACCTTGTAATTTTAATTTCTTTACAATATGCCCAATAACAA
AGCCCAGACTCGCTCGTTGATGAGGATGCTGAAGAAGGATGTTGTTGAGC
AGCTCTTAGCGGAAAGGAAAAAAAGTGAGCAAAAGGACAAGCAACTGGCG
AAGCTAAATATTACAACTCAAGAGAAGGATAAAATGCGCGAGGAGGAACT
CAAGCTATATTACCAAATGGAAGAAGAGATAACCAATCAGAAATTATTGC
AAGAGCAGTTGTTGTTCGAGTCCAAGGACGAATTAACACAGCAGCTTGAG
AAGATTGCCATCGAAAATACTTGCTGCATATGCCTGGATCCTTGGGAAGC
GAAGGATCATCACCGCTTGGTTTCGCTTAGATGTGGTCACCTTTTTGGGG
AGATGTGCATCCGGACCCACTTGCAGCATGCCGATATGTGCCCAATATGC
CGCAAAGTAGCTATTGAAAGAGACGTCTGGCGTGTGTTATTAAACACGCC
ATAAAATTATTTTCTATAAATACGATGTTCTAGCTATAATATAGTGCGTT
GATAAGCGCGATCGATTTAATCGATAAACATAAATTTTAATACCTCGATT
ATATTTCCGACTATATTCCAATTTTTTCATATTTAGGAGGGGATACAATT
GAATAATTACCAAATGGTTTGGGAAACATGCATTTGCAACAATAAATTAA
TATAAAAAAATTAAAAAAAAAAAAAAAAAA

IP04788.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG31807-RA 712 CG31807-RA 1..712 1..712 3560 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16680388..16681099 712..1 3560 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16681691..16682402 712..1 3560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16681691..16682402 712..1 3560 100 Minus
Blast to na_te.dros performed 2019-03-16 05:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 3212..3305 624..537 111 64.9 Minus

IP04788.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:23:02 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16680408..16681099 1..692 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:22 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..468 37..504 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:46 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..468 37..504 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:02:59 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..468 37..504 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:13 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..468 37..504 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:01:54 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..468 37..504 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:13 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:46 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:02:59 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..584 1..584 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:15 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..712 1..712 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:54 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
CG31807-RA 1..584 1..584 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:02 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16681691..16682402 1..712 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:02 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16681691..16682402 1..712 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:02 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16681691..16682402 1..712 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:02:59 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16681691..16682402 1..712 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:46 Download gff for IP04788.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16681691..16682402 1..712 100   Minus

IP04788.hyp Sequence

Translation from 36 to 503

> IP04788.hyp
MPNNKAQTRSLMRMLKKDVVEQLLAERKKSEQKDKQLAKLNITTQEKDKM
REEELKLYYQMEEEITNQKLLQEQLLFESKDELTQQLEKIAIENTCCICL
DPWEAKDHHRLVSLRCGHLFGEMCIRTHLQHADMCPICRKVAIERDVWRV
LLNTP*

IP04788.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31807-PA 155 CG31807-PA 1..155 1..155 814 100 Plus
CG31807-PB 142 CG31807-PB 1..142 14..155 748 100 Plus
CG13481-PC 176 CG13481-PC 33..169 21..150 231 37.2 Plus
CG13481-PB 176 CG13481-PB 33..169 21..150 231 37.2 Plus
CG33552-PA 157 CG33552-PA 4..136 9..143 202 32.6 Plus

IP04788.pep Sequence

Translation from 36 to 503

> IP04788.pep
MPNNKAQTRSLMRMLKKDVVEQLLAERKKSEQKDKQLAKLNITTQEKDKM
REEELKLYYQMEEEITNQKLLQEQLLFESKDELTQQLEKIAIENTCCICL
DPWEAKDHHRLVSLRCGHLFGEMCIRTHLQHADMCPICRKVAIERDVWRV
LLNTP*

IP04788.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21387-PA 378 GF21387-PA 96..220 16..140 231 40.7 Plus
Dana\GF21156-PA 369 GF21156-PA 306..358 95..147 191 56.6 Plus
Dana\GF11644-PA 261 GF11644-PA 90..195 49..155 186 38.3 Plus
Dana\GF20023-PA 161 GF20023-PA 73..141 72..139 178 47.8 Plus
Dana\GF10504-PA 763 GF10504-PA 282..340 95..147 162 54.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20119-PA 156 GG20119-PA 1..153 1..153 473 62.1 Plus
Dere\GG21800-PA 134 GG21800-PA 52..124 78..150 216 53.4 Plus
Dere\GG24361-PA 210 GG24361-PA 41..181 28..147 196 34 Plus
Dere\GG13729-PA 176 GG13729-PA 95..170 76..151 187 44.7 Plus
Dere\GG25198-PA 177 GG25198-PA 49..169 33..150 183 36.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15222-PA 692 GH15222-PA 213..271 95..147 156 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG31807-PA 155 CG31807-PA 1..155 1..155 814 100 Plus
CG31807-PB 142 CG31807-PB 1..142 14..155 748 100 Plus
CG13481-PC 176 CG13481-PC 33..169 21..150 231 37.2 Plus
CG13481-PB 176 CG13481-PB 33..169 21..150 231 37.2 Plus
CG33552-PA 157 CG33552-PA 4..136 9..143 202 32.6 Plus
CG17329-PA 162 CG17329-PA 27..154 26..150 183 35.2 Plus
CG13025-PB 608 CG13025-PB 130..188 95..147 162 54.2 Plus
CG13025-PA 608 CG13025-PA 130..188 95..147 162 54.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12097-PA 263 GI12097-PA 199..258 95..154 185 46.7 Plus
Dmoj\GI13216-PA 214 GI13216-PA 98..213 46..155 163 41.2 Plus
Dmoj\GI11932-PA 684 GI11932-PA 202..260 95..147 155 52.5 Plus
Dmoj\GI15028-PA 241 GI15028-PA 173..238 87..152 141 39.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15113-PA 259 GL15113-PA 193..243 94..144 178 56.9 Plus
Dper\GL19299-PA 159 GL19299-PA 47..158 45..153 173 35.7 Plus
Dper\GL15997-PA 175 GL15997-PA 111..169 81..139 173 49.2 Plus
Dper\GL15116-PA 178 GL15116-PA 107..168 86..147 169 48.4 Plus
Dper\GL20866-PA 240 GL20866-PA 198..235 95..132 149 68.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26106-PA 186 GA26106-PA 112..186 81..155 181 44 Plus
Dpse\GA25907-PA 159 GA25907-PA 47..158 45..153 178 36.5 Plus
Dpse\GA25508-PA 301 GA25508-PA 235..285 94..144 178 56.9 Plus
Dpse\GA25513-PA 178 GA25513-PA 107..168 86..147 172 48.4 Plus
Dpse\GA11982-PA 677 GA11982-PA 198..256 95..147 163 52.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17169-PA 155 GM17169-PA 1..155 1..155 710 85.8 Plus
Dsec\GM17193-PA 156 GM17193-PA 6..144 11..151 211 35.4 Plus
Dsec\GM18080-PA 164 GM18080-PA 74..135 81..142 196 51.6 Plus
Dsec\GM18662-PA 176 GM18662-PA 57..168 42..150 178 36.6 Plus
Dsec\GM24368-PA 601 GM24368-PA 123..181 95..147 167 54.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21906-PA 155 GD21906-PA 1..155 1..155 711 85.8 Plus
Dsim\GD24069-PA 1318 GD24069-PA 4..139 9..146 227 34.8 Plus
Dsim\GD22698-PA 164 GD22698-PA 74..135 81..142 196 51.6 Plus
Dsim\GD24047-PA 176 GD24047-PA 94..168 76..150 177 44 Plus
Dsim\GD12443-PA 601 GD12443-PA 123..181 95..147 167 54.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:10:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11990-PA 229 GJ11990-PA 96..228 33..155 186 40.3 Plus
Dvir\GJ13370-PA 108 GJ13370-PA 17..102 71..152 178 43 Plus
Dvir\GJ11989-PA 96 GJ11989-PA 25..95 85..155 168 43.1 Plus
Dvir\GJ15380-PA 258 GJ15380-PA 132..255 37..153 161 33.1 Plus
Dvir\GJ13368-PA 265 GJ13368-PA 192..260 84..150 154 49.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19353-PA 135 GK19353-PA 69..116 95..142 154 52.1 Plus
Dwil\GK13567-PA 671 GK13567-PA 191..249 95..147 153 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13175-PA 154 GE13175-PA 1..154 1..155 449 62.8 Plus
Dyak\GE11876-PA 220 GE11876-PA 149..219 81..151 224 49.3 Plus
Dyak\GE14698-PA 263 GE14698-PA 145..230 69..155 197 39.1 Plus
Dyak\GE20024-PA 176 GE20024-PA 32..170 20..151 194 33.8 Plus
Dyak\GE22190-PA 662 GE22190-PA 184..242 95..147 168 54.2 Plus