Clone IP04789 Report

Search the DGRC for IP04789

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:89
Vector:pOT2
Associated Gene/TranscriptCG31816-RA
Protein status:IP04789.pep: gold
Preliminary Size:501
Sequenced Size:510

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31816 2005-01-01 Successful iPCR screen
CG31816 2008-04-29 Release 5.5 accounting
CG31816 2008-08-15 Release 5.9 accounting
CG31816 2008-12-18 5.12 accounting

Clone Sequence Records

IP04789.complete Sequence

510 bp assembled on 2006-11-09

GenBank Submission: BT023660

> IP04789.complete
TTAATCCATAAATTTATCGCTTTAGGAAATGCGTTTTCAAAAATCTTAAG
TTTTTATACATTGTCACCGACAAAATCTTAGTGAAACCGGTATAAATAAT
CCCCTCATGAAATGAATAAGCAGACCAAAGAATGGTCGCGAGCTCGCCTA
TGTAAGCCTAAGGATAATCTTACCACCGAAGCGGGAAAACGAGAACGCTT
TGTGCCGTCCTGCGAGCTAGAGTGCAGTCCGGTATCGATGTCGCACTTGA
TTGGCTGGGAGTACGCTAGAATTTGGCTGCGCGATCGCGACGAATTTGTG
CAGCAACGCGAACGTGCTGTCAAAGCTAAATACATCAAGAATGACTTCGA
GTGGTGGTTAAGGCTGCGAAAAACATCGAAAAAGTTCTGCAAAGTTGGGG
CATAGAAGCGACAAAATAATGAGGACAGCGAAATTATTCCTATTCCATTT
TTAAGGGAATATACAGTTATTAAAATAAAATATTTTCATACCCAAAAAAA
AAAAAAAAAA

IP04789.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG31816-RA 590 CG31816-RA 84..578 1..495 2475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:08:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16541731..16542003 221..493 1365 100 Plus
chr2L 23010047 chr2L 16541302..16541523 1..222 1110 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16542991..16543265 221..495 1375 100 Plus
2L 23513712 2L 16542562..16542783 1..222 1110 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16542991..16543265 221..495 1375 100 Plus
2L 23513712 2L 16542562..16542783 1..222 1110 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:08:08 has no hits.

IP04789.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:09:22 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16541302..16541523 1..222 100 -> Plus
chr2L 16541733..16542003 223..493 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:23 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 1..294 112..405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:44 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 1..294 112..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:53:24 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 1..294 112..405 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:13 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 1..294 112..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:06 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 1..294 112..405 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:06 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 17..509 1..493 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:44 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 17..509 1..493 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:53:24 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 17..509 1..493 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:14 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 7..499 1..493 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:06 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
CG31816-RA 17..509 1..493 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:22 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16542562..16542783 1..222 100 -> Plus
2L 16542993..16543263 223..493 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:22 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16542562..16542783 1..222 100 -> Plus
2L 16542993..16543263 223..493 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:22 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16542562..16542783 1..222 100 -> Plus
2L 16542993..16543263 223..493 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:53:24 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16542562..16542783 1..222 100 -> Plus
arm_2L 16542993..16543263 223..493 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:01 Download gff for IP04789.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16542562..16542783 1..222 100 -> Plus
2L 16542993..16543263 223..493 100   Plus

IP04789.hyp Sequence

Translation from 111 to 404

> IP04789.hyp
MNKQTKEWSRARLCKPKDNLTTEAGKRERFVPSCELECSPVSMSHLIGWE
YARIWLRDRDEFVQQRERAVKAKYIKNDFEWWLRLRKTSKKFCKVGA*

IP04789.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31816-PA 97 CG31816-PA 1..97 1..97 531 100 Plus

IP04789.pep Sequence

Translation from 111 to 404

> IP04789.pep
MNKQTKEWSRARLCKPKDNLTTEAGKRERFVPSCELECSPVSMSHLIGWE
YARIWLRDRDEFVQQRERAVKAKYIKNDFEWWLRLRKTSKKFCKVGA*

IP04789.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13998-PA 99 GF13998-PA 1..97 1..94 374 73.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22752-PA 97 GG22752-PA 1..97 1..97 501 97.9 Plus
Dere\GG19775-PA 55 GG19775-PA 1..55 43..97 280 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25193-PA 100 GH25193-PA 6..100 4..95 284 57.9 Plus
Dgri\GH13914-PA 100 GH13914-PA 6..100 4..95 274 55.8 Plus
Dgri\GH23431-PA 53 GH23431-PA 1..53 43..95 169 58.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG31816-PA 97 CG31816-PA 1..97 1..97 531 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17262-PA 98 GI17262-PA 5..98 4..95 278 56.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19643-PA 96 GL19643-PA 4..95 5..95 309 63 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16500-PA 96 GA16500-PA 4..95 5..95 311 63 Plus
Dpse\GA22418-PA 96 GA22418-PA 4..95 5..95 309 63 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17185-PA 97 GM17185-PA 1..97 1..97 497 95.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24061-PA 97 GD24061-PA 1..97 1..97 491 94.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22692-PA 99 GJ22692-PA 8..97 6..93 239 56 Plus
Dvir\GJ22681-PA 74 GJ22681-PA 5..74 3..96 160 42.6 Plus
Dvir\GJ16600-PA 164 GJ16600-PA 3..89 5..87 130 36.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19367-PA 96 GK19367-PA 4..95 5..94 293 64.1 Plus
Dwil\GK18969-PA 126 GK18969-PA 30..87 30..87 144 41.4 Plus
Dwil\GK18970-PA 163 GK18970-PA 32..89 32..91 137 40 Plus
Dwil\GK16397-PA 179 GK16397-PA 31..92 27..88 137 38.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12747-PA 97 GE12747-PA 1..97 1..97 503 99 Plus