BDGP Sequence Production Resources |
Search the DGRC for IP04789
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 47 |
Well: | 89 |
Vector: | pOT2 |
Associated Gene/Transcript | CG31816-RA |
Protein status: | IP04789.pep: gold |
Preliminary Size: | 501 |
Sequenced Size: | 510 |
Gene | Date | Evidence |
---|---|---|
CG31816 | 2005-01-01 | Successful iPCR screen |
CG31816 | 2008-04-29 | Release 5.5 accounting |
CG31816 | 2008-08-15 | Release 5.9 accounting |
CG31816 | 2008-12-18 | 5.12 accounting |
510 bp assembled on 2006-11-09
GenBank Submission: BT023660
> IP04789.complete TTAATCCATAAATTTATCGCTTTAGGAAATGCGTTTTCAAAAATCTTAAG TTTTTATACATTGTCACCGACAAAATCTTAGTGAAACCGGTATAAATAAT CCCCTCATGAAATGAATAAGCAGACCAAAGAATGGTCGCGAGCTCGCCTA TGTAAGCCTAAGGATAATCTTACCACCGAAGCGGGAAAACGAGAACGCTT TGTGCCGTCCTGCGAGCTAGAGTGCAGTCCGGTATCGATGTCGCACTTGA TTGGCTGGGAGTACGCTAGAATTTGGCTGCGCGATCGCGACGAATTTGTG CAGCAACGCGAACGTGCTGTCAAAGCTAAATACATCAAGAATGACTTCGA GTGGTGGTTAAGGCTGCGAAAAACATCGAAAAAGTTCTGCAAAGTTGGGG CATAGAAGCGACAAAATAATGAGGACAGCGAAATTATTCCTATTCCATTT TTAAGGGAATATACAGTTATTAAAATAAAATATTTTCATACCCAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31816-RA | 590 | CG31816-RA | 84..578 | 1..495 | 2475 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 16541302..16541523 | 1..222 | 100 | -> | Plus |
chr2L | 16541733..16542003 | 223..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 1..294 | 112..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 1..294 | 112..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 1..294 | 112..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 1..294 | 112..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 1..294 | 112..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 17..509 | 1..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 17..509 | 1..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 17..509 | 1..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 7..499 | 1..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31816-RA | 17..509 | 1..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16542562..16542783 | 1..222 | 100 | -> | Plus |
2L | 16542993..16543263 | 223..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16542562..16542783 | 1..222 | 100 | -> | Plus |
2L | 16542993..16543263 | 223..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16542562..16542783 | 1..222 | 100 | -> | Plus |
2L | 16542993..16543263 | 223..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 16542562..16542783 | 1..222 | 100 | -> | Plus |
arm_2L | 16542993..16543263 | 223..493 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 16542562..16542783 | 1..222 | 100 | -> | Plus |
2L | 16542993..16543263 | 223..493 | 100 | Plus |
Translation from 111 to 404
> IP04789.hyp MNKQTKEWSRARLCKPKDNLTTEAGKRERFVPSCELECSPVSMSHLIGWE YARIWLRDRDEFVQQRERAVKAKYIKNDFEWWLRLRKTSKKFCKVGA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31816-PA | 97 | CG31816-PA | 1..97 | 1..97 | 531 | 100 | Plus |
Translation from 111 to 404
> IP04789.pep MNKQTKEWSRARLCKPKDNLTTEAGKRERFVPSCELECSPVSMSHLIGWE YARIWLRDRDEFVQQRERAVKAKYIKNDFEWWLRLRKTSKKFCKVGA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13998-PA | 99 | GF13998-PA | 1..97 | 1..94 | 374 | 73.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22752-PA | 97 | GG22752-PA | 1..97 | 1..97 | 501 | 97.9 | Plus |
Dere\GG19775-PA | 55 | GG19775-PA | 1..55 | 43..97 | 280 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH25193-PA | 100 | GH25193-PA | 6..100 | 4..95 | 284 | 57.9 | Plus |
Dgri\GH13914-PA | 100 | GH13914-PA | 6..100 | 4..95 | 274 | 55.8 | Plus |
Dgri\GH23431-PA | 53 | GH23431-PA | 1..53 | 43..95 | 169 | 58.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31816-PA | 97 | CG31816-PA | 1..97 | 1..97 | 531 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17262-PA | 98 | GI17262-PA | 5..98 | 4..95 | 278 | 56.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19643-PA | 96 | GL19643-PA | 4..95 | 5..95 | 309 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16500-PA | 96 | GA16500-PA | 4..95 | 5..95 | 311 | 63 | Plus |
Dpse\GA22418-PA | 96 | GA22418-PA | 4..95 | 5..95 | 309 | 63 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17185-PA | 97 | GM17185-PA | 1..97 | 1..97 | 497 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24061-PA | 97 | GD24061-PA | 1..97 | 1..97 | 491 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22692-PA | 99 | GJ22692-PA | 8..97 | 6..93 | 239 | 56 | Plus |
Dvir\GJ22681-PA | 74 | GJ22681-PA | 5..74 | 3..96 | 160 | 42.6 | Plus |
Dvir\GJ16600-PA | 164 | GJ16600-PA | 3..89 | 5..87 | 130 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19367-PA | 96 | GK19367-PA | 4..95 | 5..94 | 293 | 64.1 | Plus |
Dwil\GK18969-PA | 126 | GK18969-PA | 30..87 | 30..87 | 144 | 41.4 | Plus |
Dwil\GK18970-PA | 163 | GK18970-PA | 32..89 | 32..91 | 137 | 40 | Plus |
Dwil\GK16397-PA | 179 | GK16397-PA | 31..92 | 27..88 | 137 | 38.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12747-PA | 97 | GE12747-PA | 1..97 | 1..97 | 503 | 99 | Plus |