Clone IP04796 Report

Search the DGRC for IP04796

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:47
Well:96
Vector:pOT2
Associated Gene/TranscriptCG32023-RA
Protein status:IP04796.pep: gold
Preliminary Size:429
Sequenced Size:544

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32023 2005-01-01 Successful iPCR screen
CG32023 2008-04-29 Release 5.5 accounting
CG32023 2008-08-15 Release 5.9 accounting
CG32023 2008-12-18 5.12 accounting

Clone Sequence Records

IP04796.complete Sequence

544 bp (544 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022257

> IP04796.complete
CAAAATGCAGTATACTCAGCTCCTGAGAGTTTTGTGCTCCATCGTGATCA
TATCCTATATGGCAGTCCATGTTCTCGGGGACATAAAATGCAATGTGTGT
CAACCAAATCATGTCAAGTGCCTGAACGAGACCCACTTTAGTTTTTGCCT
CGACGCCGTTTCGTCGGATCAGGTTATCCAGTGTCCCGACGGCCAGGTTT
GCACCAGCCTCCTGAAGATCTGCCTGCCCAAGGGATCGACTCCAGCTTCC
TGCACTCCAGATGCCGAAATATCGTGTCCTCCTTGCAGTGGAGCAGGTCT
ATTCGTCTGCACTAGCCGCACCACCTTCCAAATGTGTGATGAAGGCAAGC
TCATCGGCCAAGTAACGAAGTGCAAGGATAACACTTTCTGCTCCATGAAG
TCGAAAAAGTTTTGCGTAGATCAGTGTGAAATAACGAAATCTCAAAATGG
ATTCGAGTGCGACAGAGAGTCCCCCTTGGATGTATAAATATAAAGCTCCA
AAATACAATACTAAAAGGAAGAACGAAAAAAAAAAAAAAAAAAA

IP04796.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG32023-RA 560 CG32023-RA 36..560 1..525 2625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8795545..8796036 525..34 2415 99.4 Minus
chr3L 24539361 chr3L 8793620..8793721 403..302 180 78.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8803599..8804093 528..34 2475 100 Minus
3L 28110227 3L 8801679..8801780 403..302 180 78.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8796699..8797193 528..34 2475 100 Minus
3L 28103327 3L 8794779..8794880 403..302 180 78.4 Minus
3L 28103327 3L 8797249..8797282 34..1 170 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:28:55 has no hits.

IP04796.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:30:19 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8795545..8796035 35..525 99 <- Minus
chr3L 8796092..8796125 1..34 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:25 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..483 5..487 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:30 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..483 5..487 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:29:31 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..483 5..487 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:33 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..483 5..487 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:07:16 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..483 5..487 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:02 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:30 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:29:31 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:33 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..525 1..525 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:07:16 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
CG32023-RA 1..525 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:19 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8803602..8804092 35..525 100 <- Minus
3L 8804149..8804182 1..34 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:19 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8803602..8804092 35..525 100 <- Minus
3L 8804149..8804182 1..34 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:30:19 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8803602..8804092 35..525 100 <- Minus
3L 8804149..8804182 1..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:29:31 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8796702..8797192 35..525 100 <- Minus
arm_3L 8797249..8797282 1..34 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:45 Download gff for IP04796.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8796702..8797192 35..525 100 <- Minus
3L 8797249..8797282 1..34 100   Minus

IP04796.hyp Sequence

Translation from 0 to 486

> IP04796.hyp
KMQYTQLLRVLCSIVIISYMAVHVLGDIKCNVCQPNHVKCLNETHFSFCL
DAVSSDQVIQCPDGQVCTSLLKICLPKGSTPASCTPDAEISCPPCSGAGL
FVCTSRTTFQMCDEGKLIGQVTKCKDNTFCSMKSKKFCVDQCEITKSQNG
FECDRESPLDV*

IP04796.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG32023-PA 160 CG32023-PA 1..160 2..161 877 100 Plus
CG13311-PA 153 CG13311-PA 1..153 2..159 491 59.5 Plus
CG14958-PA 145 CG14958-PA 1..132 7..139 210 34.6 Plus
CG34427-PB 269 CG34427-PB 14..143 14..141 194 36.6 Plus
CG13309-PA 229 CG13309-PA 4..124 16..138 156 31.1 Plus

IP04796.pep Sequence

Translation from 4 to 486

> IP04796.pep
MQYTQLLRVLCSIVIISYMAVHVLGDIKCNVCQPNHVKCLNETHFSFCLD
AVSSDQVIQCPDGQVCTSLLKICLPKGSTPASCTPDAEISCPPCSGAGLF
VCTSRTTFQMCDEGKLIGQVTKCKDNTFCSMKSKKFCVDQCEITKSQNGF
ECDRESPLDV*

IP04796.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20111-PA 145 GF20111-PA 1..144 11..157 433 57.8 Plus
Dana\GF10145-PA 151 GF10145-PA 1..151 1..156 402 53.2 Plus
Dana\GF10121-PA 147 GF10121-PA 1..136 6..140 166 35 Plus
Dana\GF24357-PA 272 GF24357-PA 27..143 28..140 155 37.8 Plus
Dana\GF24356-PA 320 GF24356-PA 2..144 5..147 139 31.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15056-PA 158 GG15056-PA 1..158 1..160 594 72.5 Plus
Dere\GG15057-PA 154 GG15057-PA 1..154 1..158 433 56.6 Plus
Dere\GG15111-PA 148 GG15111-PA 25..135 29..138 167 38.9 Plus
Dere\GG14349-PA 505 GG14349-PA 8..148 14..154 155 34 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16137-PA 150 GH16137-PA 3..143 13..155 246 41.1 Plus
Dgri\GH10924-PA 155 GH10924-PA 24..135 28..138 164 36 Plus
Dgri\GH15329-PA 430 GH15329-PA 6..152 5..154 147 31.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32023-PA 160 CG32023-PA 1..160 1..160 877 100 Plus
CG13311-PA 153 CG13311-PA 1..153 1..158 491 59.5 Plus
CG14958-PA 145 CG14958-PA 1..132 6..138 210 34.6 Plus
CG34427-PB 269 CG34427-PB 14..143 13..140 194 36.6 Plus
CG13309-PA 229 CG13309-PA 4..124 15..137 156 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12406-PA 156 GI12406-PA 7..156 13..159 215 32 Plus
Dmoj\GI13368-PA 149 GI13368-PA 5..136 10..138 184 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24894-PA 143 GL24894-PA 6..125 23..138 157 36.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12192-PA 156 GA12192-PA 1..156 1..157 371 48.8 Plus
Dpse\GA13383-PA 150 GA13383-PA 21..132 28..138 152 36.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24913-PA 168 GM24913-PA 1..160 1..160 753 89.4 Plus
Dsec\GM24914-PA 153 GM24914-PA 1..153 1..158 431 60.8 Plus
Dsec\GM14547-PA 145 GM14547-PA 1..132 6..138 174 34.6 Plus
Dsec\GM25094-PA 245 GM25094-PA 1..126 19..142 152 35.9 Plus
Dsec\GM25093-PA 300 GM25093-PA 1..154 7..160 143 30.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12960-PA 160 GD12960-PA 1..160 1..160 751 90.6 Plus
Dsim\GD12961-PA 153 GD12961-PA 1..153 1..158 431 60.8 Plus
Dsim\GD13738-PA 145 GD13738-PA 1..132 6..138 175 34.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12296-PA 158 GJ12296-PA 28..158 29..157 235 38.5 Plus
Dvir\GJ12008-PA 149 GJ12008-PA 7..136 12..138 162 33.3 Plus
Dvir\GJ13074-PA 420 GJ13074-PA 3..141 5..142 144 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17468-PA 151 GK17468-PA 1..151 1..157 278 42.5 Plus
Dwil\GK13204-PA 148 GK13204-PA 7..137 14..140 179 37.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21280-PA 160 GE21280-PA 1..160 1..160 656 78.8 Plus
Dyak\GE21281-PA 154 GE21281-PA 1..154 1..158 402 56.6 Plus
Dyak\GE21338-PA 148 GE21338-PA 24..135 28..138 167 37.7 Plus
Dyak\GE20782-PA 266 GE20782-PA 14..143 13..140 159 34.3 Plus
Dyak\GE20779-PA 308 GE20779-PA 1..154 7..160 158 31.2 Plus