Clone IP04820 Report

Search the DGRC for IP04820

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:48
Well:20
Vector:pOT2
Associated Gene/TranscriptCG32937-RA
Protein status:IP04820.pep: validated full length
Preliminary Size:447
Sequenced Size:969

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32937 2005-01-01 Successful iPCR screen
CG32937 2008-04-29 Release 5.5 accounting
CG32937 2008-08-15 Release 5.9 accounting
CG32937 2008-12-18 5.12 accounting

Clone Sequence Records

IP04820.complete Sequence

969 bp (969 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023657

> IP04820.complete
TGCCGTGAAGATGACTTTGGCTCGTTTTGGATGGTCGACGATAATGAGTT
TGTCAAAAGGCGGCACTTGTCGAGAGGGAGACCCCGGAAATATGAACCGT
CCTCCTCCCCAAATTCATGCCAATCCGGCAATGGTGTGCCCACTGATAAG
AATCCCTGCGACAATTGTACGCAACATTGCACTAGTTTGCCACCGGGTGC
TGATAATCCTCTAGATTCCAATAATCCAAATGATTTAGGCAGAATTGGTT
GTCTTCCCTATTGCGGTAGTGATGGTTTAAGTAAAGCGTCCAAGGACTAT
AGCAATATGGACTCGGGTATGATCGAAAGTAACAGCCACTTGACAATCGA
TGAATATTCTACTAATATGTACGAGAGTAGTGCCAATGAGCACAATCGAT
AAATAATATATCATTAACTATACATATATTTAGATGCATTGTCGAGTAAT
CTGCGTTTGGTAAGAAGGTTCGGATTCGGAAATTATATCTGTACATACAC
ATGGTTCTATGTATAATTTCCCAAATAGAAATGAAAAAATACTTTTAAAA
TAAATTTCACTAATGCTATAAAATAAACGAAAGAACTACGTTAAATTATT
AAAGCAAAATTAATGTGTTTAAACTTGCTTTAATAACTCCACTTATAACA
CGATTTTAATATACGAGTACAACATATATGAATATTTTCACTTTTCAGCA
AGGGAGAAAACATTTAAAAGCTATAGCTTGATAAAATTTTAACAAAACTG
TTTTAAAAGTCACAATATGATTTTTTTTTAAGGAAACTATTTTCAGGTAT
ACCTTCTGTTAAAAATCTGGACCCTTGAGAGCTTTAGATTTGGAAACTCC
TTAGTAAACGTATATGCTTTTCTGCTGACTTATCTAATTTCCTTCTAATT
TAAGATCATTAACGATACTCAGTGACCTAAATAAATTCCTCAAATATACA
ACAAAAAAAAAAAAAAAAA

IP04820.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG32937-RA 1000 CG32937-RA 51..1000 6..955 4750 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5551853..5552798 952..6 4640 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9726017..9726966 955..6 4750 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9466848..9467797 955..6 4750 100 Minus
Blast to na_te.dros performed on 2019-03-16 15:36:56 has no hits.

IP04820.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:37:48 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5551853..5552800 1..952 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:31 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
CG32937-RA 1..372 31..402 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:47 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
fd85E-RC 1162..1563 1..402 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:50:09 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
FoxP-RC 1162..1563 1..402 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:16 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
CG32937-RA 1..372 31..402 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:50:37 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
FoxP-RC 1162..1563 1..402 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:15 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
CG32937-RA 46..997 1..952 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:47 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
fd85E-RC 1172..2123 1..952 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:50:09 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
FoxP-RC 1172..2123 1..952 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:16 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
CG32937-RA 46..997 1..952 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:50:37 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
FoxP-RC 2408..3359 1..952 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:37:48 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9726020..9726968 1..952 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:37:48 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9726020..9726968 1..952 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:37:48 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9726020..9726968 1..952 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:50:09 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5551742..5552690 1..952 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:47 Download gff for IP04820.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9466851..9467799 1..952 99   Minus

IP04820.hyp Sequence

Translation from 0 to 401

> IP04820.hyp
YEDDFGSFWMVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKN
PCDNCTQHCTSLPPGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYS
NMDSGMIESNSHLTIDEYSTNMYESSANEHNR*

IP04820.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
FoxP-PC 520 CG43067-PC 389..520 1..132 739 100 Plus

IP04820.pep Sequence

Translation from 30 to 401

> IP04820.pep
MVDDNEFVKRRHLSRGRPRKYEPSSSPNSCQSGNGVPTDKNPCDNCTQHC
TSLPPGADNPLDSNNPNDLGRIGCLPYCGSDGLSKASKDYSNMDSGMIES
NSHLTIDEYSTNMYESSANEHNR*

IP04820.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20143-PA 125 GF20143-PA 1..125 1..123 536 82.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17339-PA 123 GG17339-PA 1..123 1..123 622 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17224-PA 78 GH17224-PA 1..62 1..62 167 61.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
FoxP-PC 520 CG43067-PC 398..520 1..123 682 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16927-PA 135 GI16927-PA 1..133 1..121 183 37.7 Plus
Dmoj\GI16899-PA 135 GI16899-PA 1..133 1..121 183 37.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:10:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21961-PA 116 GL21961-PA 1..114 1..123 286 52 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30170-PB 505 GA30170-PB 390..503 1..123 289 53.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26225-PA 122 GM26225-PA 1..122 1..123 620 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20769-PA 123 GD20769-PA 1..123 1..123 637 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17101-PA 140 GJ17101-PA 1..93 1..96 186 46.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13410-PA 2669 GK13410-PA 1..70 1..72 201 66.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24744-PA 123 GE24744-PA 1..123 1..123 610 92.7 Plus