Clone IP04848 Report

Search the DGRC for IP04848

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:48
Well:48
Vector:pOT2
Associated Gene/TranscriptLSm1-RA
Protein status:IP04848.pep: gold
Preliminary Size:415
Sequenced Size:558

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4279 2005-01-01 Successful iPCR screen
CG4279 2008-04-29 Release 5.5 accounting
CG4279 2008-08-15 Release 5.9 accounting
CG4279 2008-12-18 5.12 accounting

Clone Sequence Records

IP04848.complete Sequence

558 bp (558 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022249

> IP04848.complete
TTTATCTAAATCCCACATATTTTCATAGCATGGACGACTTAAATCCGCTG
GCGGGCACTGCTCACCTCCTGGAAGAGGTTGACAAGAAACTGATGGTACT
TTTGAGAGACGGACGGACTCTGATTGGATACCTGCGGTCCGTGGACCAGT
TCGCCAACCTGGTGCTGCAACGCACCATCGAGCGGATACATGTGGGCAAC
GAATACGGCGACATTCCTCGCGGAGTCTTCATCATTCGCGGGGAGAATGT
GGTGCTACTGGGCGAAATAGACCGTGAAAAGGAGCAGAAACTGCCACTCA
AAGAGATATCCGTCGATGAAATCCTGGACGCCCAGCGTAGGGAACAGGAG
CAGCGGCAGGAGAAACACCGCCTAGTATCCAAGGCACTAAAGGAACGAGG
CCTGGCCGTAGATGCCAACATAATCAACGAGGACTTCTGCTAAGACTCCA
TTTTTTCCTAAGCACAAAGTTAGATTAAGCTCAAAAGATTTTCGTCTCTT
TGTATATTTGTACTGCATTAAAAAACTATGTTAAAACCTAAAAAAAAAAA
AAAAAAAA

IP04848.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
LSm1-RA 693 LSm1-RA 71..610 1..540 2685 99.8 Plus
CG9437-RA 1051 CG9437-RA 1009..1051 540..498 215 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17056428..17056697 539..270 1335 99.6 Minus
chr2R 21145070 chr2R 17056759..17056944 270..85 900 98.9 Minus
chr2R 21145070 chr2R 17056999..17057082 84..1 405 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21169968..21170238 540..270 1355 100 Minus
2R 25286936 2R 21170300..21170485 270..85 930 100 Minus
2R 25286936 2R 21170540..21170623 84..1 405 98.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21171167..21171437 540..270 1355 100 Minus
2R 25260384 2R 21171499..21171684 270..85 930 100 Minus
2R 25260384 2R 21171739..21171822 84..1 405 98.8 Minus
Blast to na_te.dros performed on 2019-03-16 09:35:37 has no hits.

IP04848.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:36:25 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17056428..17056697 270..539 99 <- Minus
chr2R 17056760..17056944 85..269 98 <- Minus
chr2R 17056999..17057082 1..84 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:33 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
CG4279-RA 1..414 30..443 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:35 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
LSm1-RA 1..414 30..443 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:50:40 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
LSm1-RA 1..414 30..443 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:37 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
CG4279-RA 1..414 30..443 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:17 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
LSm1-RA 1..414 30..443 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:09 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
CG4279-RA 23..561 1..539 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:35 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
LSm1-RA 23..561 1..539 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:50:40 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
LSm1-RA 50..588 1..539 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:37 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
CG4279-RA 23..561 1..539 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:17 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
LSm1-RA 50..588 1..539 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:25 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21169969..21170238 270..539 100 <- Minus
2R 21170301..21170485 85..269 100 <- Minus
2R 21170540..21170623 1..84 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:25 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21169969..21170238 270..539 100 <- Minus
2R 21170301..21170485 85..269 100 <- Minus
2R 21170540..21170623 1..84 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:36:25 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21169969..21170238 270..539 100 <- Minus
2R 21170301..21170485 85..269 100 <- Minus
2R 21170540..21170623 1..84 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:50:40 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17057474..17057743 270..539 100 <- Minus
arm_2R 17057806..17057990 85..269 100 <- Minus
arm_2R 17058045..17058128 1..84 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:50 Download gff for IP04848.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21171168..21171437 270..539 100 <- Minus
2R 21171500..21171684 85..269 100 <- Minus
2R 21171739..21171822 1..84 98   Minus

IP04848.hyp Sequence

Translation from 2 to 442

> IP04848.hyp
YLNPTYFHSMDDLNPLAGTAHLLEEVDKKLMVLLRDGRTLIGYLRSVDQF
ANLVLQRTIERIHVGNEYGDIPRGVFIIRGENVVLLGEIDREKEQKLPLK
EISVDEILDAQRREQEQRQEKHRLVSKALKERGLAVDANIINEDFC*

IP04848.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
LSm1-PA 137 CG4279-PA 1..137 10..146 686 100 Plus

IP04848.pep Sequence

Translation from 29 to 442

> IP04848.pep
MDDLNPLAGTAHLLEEVDKKLMVLLRDGRTLIGYLRSVDQFANLVLQRTI
ERIHVGNEYGDIPRGVFIIRGENVVLLGEIDREKEQKLPLKEISVDEILD
AQRREQEQRQEKHRLVSKALKERGLAVDANIINEDFC*

IP04848.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12971-PA 137 GF12971-PA 1..137 1..137 686 98.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20797-PA 137 GG20797-PA 1..137 1..137 694 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21171-PA 137 GH21171-PA 1..137 1..137 681 97.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:02
Subject Length Description Subject Range Query Range Score Percent Strand
LSm1-PA 137 CG4279-PA 1..137 1..137 686 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18766-PA 137 GI18766-PA 1..137 1..137 686 98.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10169-PA 137 GL10169-PA 1..137 1..137 679 97.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18077-PA 137 GA18077-PA 1..137 1..137 679 97.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15742-PA 137 GM15742-PA 1..137 1..137 696 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25220-PA 137 GD25220-PA 1..137 1..137 696 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21790-PA 137 GJ21790-PA 1..137 1..137 680 97.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:41:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19486-PA 137 GK19486-PA 1..137 1..137 678 97.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13737-PA 137 GE13737-PA 1..137 1..137 696 100 Plus