Clone IP04855 Report

Search the DGRC for IP04855

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:48
Well:55
Vector:pOT2
Associated Gene/TranscriptCG6873-RA
Protein status:IP04855.pep: gold
Preliminary Size:447
Sequenced Size:653

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6873 2008-12-18 5.12 accounting

Clone Sequence Records

IP04855.complete Sequence

653 bp assembled on 2008-12-15

GenBank Submission: BT072940.1

> IP04855.complete
ATTTCGTACATATCTACATAAATCAAAGTTTCAAAATTTCTAGTCTCGCT
GGAATGCACTGCGATTGATCCGACTGGAGGTTAACTGTGGACTAAATCTT
GGCTGCTGCACTGAATCAACAAGCATGGCATCTGGAATTAATTTGAGCCG
CGAGTGTCAGCACGTGTTCGAGCAGATCCGGAAGCTGAAGCAACATCGCT
ACGCGGTCTTCGTCATCCAGGACGAGCGGGAGATTAAGGTGGAGGTGCTT
GGAGTAAGGGAGGCGAACTACGACGACTTCCTGGCGGATCTGCAACGTGC
CGGATCCAATCAGTGCCGATTCGCTGTCTACGACTATGAGTATCAGCACC
AGTGCCAGGGCACCTTGTCCACCTGCCTGAAGGAGAAGCTAATCCTGATG
CTCTGGTGTCCCACTCTGGCCAGGATCAAGGACAAGATGCTCTACTCCAG
CACGTTTGCGGTGCTCAAGCGAGAGTTTCCCGGCGTCCAGAAGTGCATTC
AGGCCACCGAACCGGAGGAGGCGTGCCGCAATGCTGTCGAGGAGCAGCTG
CGCTCCTTGGACAGGGAGTAGTCCTGCTGCTCCTGCAACTTCTGCTCCTT
TTGCTCCCTTTTGAAATATAGTACGGATAATTTAAAAAAAAAAAAAAAAA
AAA

IP04855.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG6873-RA 447 CG6873-RA 1..447 125..571 2235 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18628328..18628960 633..1 3120 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18739215..18739848 634..1 3170 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18747313..18747946 634..1 3170 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:28:27 has no hits.

IP04855.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:29:35 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18628328..18628960 1..633 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:15 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 1..447 125..571 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:44:57 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 1..447 125..571 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:11 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 1..447 125..571 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:00 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 1..447 125..571 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-15 11:41:28 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 1..447 125..571 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:44:57 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 48..680 1..633 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:11 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 48..680 1..633 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:00 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
CG6873-RA 48..680 1..633 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:35 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
X 18739216..18739848 1..633 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:35 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
X 18739216..18739848 1..633 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:35 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
X 18739216..18739848 1..633 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:11 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18633249..18633881 1..633 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:30:40 Download gff for IP04855.complete
Subject Subject Range Query Range Percent Splice Strand
X 18747314..18747946 1..633 100   Minus

IP04855.hyp Sequence

Translation from 124 to 570

> IP04855.hyp
MASGINLSRECQHVFEQIRKLKQHRYAVFVIQDEREIKVEVLGVREANYD
DFLADLQRAGSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLAR
IKDKMLYSSTFAVLKREFPGVQKCIQATEPEEACRNAVEEQLRSLDRE*

IP04855.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG6873-PA 148 CG6873-PA 1..148 1..148 773 100 Plus
tsr-PA 148 CG4254-PA 1..148 1..148 434 52.7 Plus

IP04855.pep Sequence

Translation from 124 to 570

> IP04855.pep
MASGINLSRECQHVFEQIRKLKQHRYAVFVIQDEREIKVEVLGVREANYD
DFLADLQRAGSNQCRFAVYDYEYQHQCQGTLSTCLKEKLILMLWCPTLAR
IKDKMLYSSTFAVLKREFPGVQKCIQATEPEEACRNAVEEQLRSLDRE*

IP04855.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19223-PA 148 GF19223-PA 1..148 1..148 648 81.1 Plus
Dana\GF13484-PA 148 GF13484-PA 1..148 1..148 443 52.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18095-PA 148 GG18095-PA 1..148 1..148 707 90.5 Plus
Dere\GG19959-PA 148 GG19959-PA 1..148 1..148 443 52.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12530-PA 148 GH12530-PA 1..147 1..147 506 61.2 Plus
Dgri\GH20162-PA 418 GH20162-PA 272..418 2..148 442 52.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG6873-PA 148 CG6873-PA 1..148 1..148 773 100 Plus
tsr-PA 148 CG4254-PA 1..148 1..148 434 52.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:11:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11187-PA 148 GI11187-PA 1..147 1..147 554 69.4 Plus
Dmoj\GI20679-PA 156 GI20679-PA 10..156 2..148 441 52.4 Plus
Dmoj\GI11766-PA 148 GI11766-PA 5..138 6..139 241 36.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10428-PA 150 GL10428-PA 4..150 2..148 433 51.7 Plus
Dper\GL27011-PA 152 GL27011-PA 1..152 1..148 423 53.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18060-PA 154 GA18060-PA 8..154 2..148 435 51.7 Plus
Dpse\GA22341-PA 152 GA22341-PA 1..152 1..148 412 52.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22788-PA 148 GM22788-PA 1..148 1..148 744 94.6 Plus
Dsec\GM18279-PA 148 GM18279-PA 1..148 1..148 443 52.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:11:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24977-PA 148 GD24977-PA 1..148 1..148 443 52.7 Plus
Dsim\GD15622-PA 68 GD15622-PA 1..68 81..148 354 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19548-PA 148 GJ19548-PA 1..147 1..147 561 70.7 Plus
Dvir\GJ21900-PA 148 GJ21900-PA 1..148 1..148 446 52.7 Plus
Dvir\GJ13471-PA 148 GJ13471-PA 2..143 3..144 246 36.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24946-PA 150 GK24946-PA 3..150 1..148 634 75.7 Plus
Dwil\GK10641-PA 149 GK10641-PA 3..149 2..148 443 53.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15494-PA 148 GE15494-PA 1..148 1..148 728 91.2 Plus
Dyak\tsr-PA 148 GE11491-PA 1..148 1..148 443 52.7 Plus