Clone IP04903 Report

Search the DGRC for IP04903

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:49
Well:3
Vector:pOT2
Associated Gene/TranscriptVha16-2-RA
Protein status:IP04903.pep: gold
Preliminary Size:477
Sequenced Size:612

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32089 2005-01-01 Successful iPCR screen
Vha16-2 2008-04-29 Release 5.5 accounting
Vha16-2 2008-08-15 Release 5.9 accounting
Vha16-2 2008-12-18 5.12 accounting

Clone Sequence Records

IP04903.complete Sequence

612 bp (612 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023658

> IP04903.complete
ATCTTTTCAACTGTTTCGATTTCAATCCGATTTAAGCAAAATGGTTACTG
CCGCTTTAAATGAAGAGCCATCATACGCCTTCTTCTTGGGATGCACGGGG
GCTGCAGTTGCGATTATATTCACGACCTTGGGAGCGTCTTACGGAACAGC
AGTTTCCGGTGTCGGAATCGCCAAGATGGCGGTCAATCGACCGGATATGA
TCATGAAGGCCATCATTCCGGTCGTAATGGCGGGAATTATTGCGATCTAC
GGATTGGTGGTATCCGTCCTGATAGCCGGATCGATTGGCGATGATTATAC
GATGGAAGACAGTTATGTGCATCTGGGCGCCGGATTGTCCGTCGGACTTC
CAGGACTCACCGCAGGAGTAGCCATTGGAATCGCAGGCGATGCTGGAGTC
CGGGGTACCGCCGAACAGCCACGCCTTTTCGTGGGCATGGTCCTGATCCT
GATCTTCGCCGAGGTCCTGGCTCTATACGGCCTCATTGTGGCCATCTATT
TGTACACTAAGCTTTAGGTTTATAAAACTTAATAATATAAAATGTTTATA
AATGAAAGCTAGCTTGGAAATAAAATACATTATAATATTATTTATAAAAA
AAAAAAAAAAAA

IP04903.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-2-RA 595 Vha16-2-RA 1..595 1..595 2975 100 Plus
Vha16-3-RA 587 Vha16-3-RA 356..496 371..511 330 82.2 Plus
Vha16-3-RB 647 Vha16-3-RB 416..556 371..511 330 82.2 Plus
Vha16-3-RA 587 Vha16-3-RA 173..267 188..282 190 80 Plus
Vha16-3-RB 647 Vha16-3-RB 233..327 188..282 190 80 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11465776..11466367 1..595 2820 98.7 Plus
chr3L 24539361 chr3L 11464376..11464699 188..511 375 74.4 Plus
chr2L 23010047 chr2L 10735402..10735538 267..131 220 77.4 Minus
chr2R 21145070 chr2R 2514676..2514755 507..428 205 83.8 Minus
chr2L 23010047 chr2L 10735156..10735247 507..416 190 80.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11474958..11475554 1..597 2985 100 Plus
3L 28110227 3L 11473558..11473881 188..511 375 74.4 Plus
2L 23513712 2L 10736638..10736774 267..131 220 77.4 Minus
2R 25286936 2R 6627477..6627556 507..428 205 83.8 Minus
2L 23513712 2L 10736392..10736483 507..416 190 80.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11468058..11468654 1..597 2985 100 Plus
3L 28103327 3L 11466841..11466981 371..511 330 82.2 Plus
2R 25260384 2R 6628676..6628755 507..428 205 83.7 Minus
3L 28103327 3L 11466658..11466752 188..282 190 80 Plus
2L 23513712 2L 10736638..10736702 267..203 190 86.1 Minus
2L 23513712 2L 10736392..10736483 507..416 190 80.4 Minus
Blast to na_te.dros performed 2019-03-16 06:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
hobo 2959 hobo DMHFL1 2959bp Derived from M69216 (g157606) (Rel. 41, Last updated, Version 3). 2298..2336 558..520 105 74.4 Minus

IP04903.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:13:23 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11465776..11466291 1..516 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:38 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..477 41..517 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:47:00 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..477 41..517 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:39:10 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..477 41..517 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:28:40 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..477 41..517 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:14:12 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..477 41..517 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:20:27 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..477 41..517 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:47:00 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..595 1..595 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:10 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..595 1..595 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:28:40 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..477 41..517 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:14:12 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-2-RA 1..595 1..595 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:23 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11474958..11475552 1..595 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:23 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11474958..11475552 1..595 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:13:23 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11474958..11475552 1..595 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:10 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11468058..11468652 1..595 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:07:12 Download gff for IP04903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11468058..11468652 1..595 100   Plus

IP04903.hyp Sequence

Translation from 0 to 516

> IP04903.hyp
SFQLFRFQSDLSKMVTAALNEEPSYAFFLGCTGAAVAIIFTTLGASYGTA
VSGVGIAKMAVNRPDMIMKAIIPVVMAGIIAIYGLVVSVLIAGSIGDDYT
MEDSYVHLGAGLSVGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLIL
IFAEVLALYGLIVAIYLYTKL*

IP04903.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-2-PA 158 CG32089-PA 1..158 14..171 774 100 Plus
Vha16-3-PB 158 CG32090-PB 5..158 17..170 582 76 Plus
Vha16-3-PA 158 CG32090-PA 5..158 17..170 582 76 Plus
Vha16-1-PB 159 CG3161-PB 1..159 14..170 529 68.6 Plus
Vha16-1-PA 159 CG3161-PA 1..159 14..170 529 68.6 Plus

IP04903.pep Sequence

Translation from 40 to 516

> IP04903.pep
MVTAALNEEPSYAFFLGCTGAAVAIIFTTLGASYGTAVSGVGIAKMAVNR
PDMIMKAIIPVVMAGIIAIYGLVVSVLIAGSIGDDYTMEDSYVHLGAGLS
VGLPGLTAGVAIGIAGDAGVRGTAEQPRLFVGMVLILIFAEVLALYGLIV
AIYLYTKL*

IP04903.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25265-PA 157 GF25265-PA 7..157 7..157 561 74.8 Plus
Dana\GF13808-PA 159 GF13808-PA 1..159 1..157 520 69.2 Plus
Dana\GF25266-PA 159 GF25266-PA 7..157 7..157 508 76.2 Plus
Dana\GF19671-PA 180 GF19671-PA 23..176 5..156 465 61 Plus
Dana\GF13441-PA 202 GF13441-PA 15..138 8..131 356 58.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15505-PA 158 GG15505-PA 1..158 1..158 699 89.9 Plus
Dere\GG15504-PA 158 GG15504-PA 5..158 4..157 563 74 Plus
Dere\GG10820-PA 159 GG10820-PA 1..159 1..157 518 68.6 Plus
Dere\GG22236-PA 158 GG22236-PA 9..158 8..157 466 60 Plus
Dere\GG10362-PA 191 GG10362-PA 34..187 5..156 461 63 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16652-PA 161 GH16652-PA 7..161 3..157 569 74.8 Plus
Dgri\GH12724-PA 161 GH12724-PA 7..161 3..157 569 74.8 Plus
Dgri\GH16653-PA 159 GH16653-PA 9..159 8..158 542 74.2 Plus
Dgri\GH22892-PA 161 GH22892-PA 10..161 8..157 522 73 Plus
Dgri\GH10920-PA 173 GH10920-PA 22..171 10..157 484 68 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-2-PA 158 CG32089-PA 1..158 1..158 774 100 Plus
Vha16-3-PB 158 CG32090-PB 5..158 4..157 582 76 Plus
Vha16-3-PA 158 CG32090-PA 5..158 4..157 582 76 Plus
Vha16-1-PB 159 CG3161-PB 1..159 1..157 529 68.6 Plus
Vha16-1-PA 159 CG3161-PA 1..159 1..157 529 68.6 Plus
Vha16-1-PD 159 CG3161-PD 1..159 1..157 529 68.6 Plus
Vha16-1-PC 159 CG3161-PC 1..159 1..157 529 68.6 Plus
Vha16-4-PA 155 CG9013-PA 6..155 8..157 473 60 Plus
Vha16-5-PA 193 CG6737-PA 37..189 6..156 462 61.4 Plus
VhaPPA1-1-PB 212 CG7007-PB 46..205 11..157 222 30.4 Plus
VhaPPA1-1-PA 212 CG7007-PA 46..205 11..157 222 30.4 Plus
VhaPPA1-2-PB 212 CG7026-PB 48..207 11..157 208 31.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11612-PA 158 GI11612-PA 8..158 7..157 565 74.8 Plus
Dmoj\GI11613-PA 158 GI11613-PA 1..158 1..158 528 68.4 Plus
Dmoj\GI21278-PA 159 GI21278-PA 8..159 8..157 518 70.4 Plus
Dmoj\GI13313-PA 175 GI13313-PA 24..173 10..157 466 65.3 Plus
Dmoj\GI22994-PA 212 GI22994-PA 46..205 11..157 186 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21511-PA 162 GL21511-PA 6..162 3..157 551 73.9 Plus
Dper\GL20293-PA 159 GL20293-PA 1..159 1..157 525 69.8 Plus
Dper\GL21512-PA 159 GL21512-PA 1..159 1..158 523 77.4 Plus
Dper\GL10498-PA 165 GL10498-PA 16..165 8..157 488 66 Plus
Dper\GL10499-PA 165 GL10499-PA 16..165 8..157 488 66 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26304-PA 162 GA26304-PA 6..162 3..157 551 73.9 Plus
Dpse\GA16335-PA 159 GA16335-PA 1..159 1..157 525 69.8 Plus
Dpse\GA26306-PA 159 GA26306-PA 1..159 1..158 525 77.4 Plus
Dpse\GA21477-PA 165 GA21477-PA 16..165 8..157 490 66 Plus
Dpse\GA25245-PA 182 GA25245-PA 27..179 6..156 465 65.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25274-PA 158 GM25274-PA 1..158 1..158 756 97.5 Plus
Dsec\GM25273-PA 158 GM25273-PA 5..158 4..157 576 76 Plus
Dsec\GM20869-PA 159 GM20869-PA 1..159 1..157 518 68.6 Plus
Dsec\GM20023-PA 158 GM20023-PA 9..158 8..157 471 60.7 Plus
Dsec\GM11483-PA 191 GM11483-PA 35..187 6..156 443 61.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14308-PA 165 GD14308-PA 1..165 1..158 681 87.9 Plus
Dsim\GD14307-PA 158 GD14307-PA 5..158 4..157 576 76 Plus
Dsim\GD10321-PA 159 GD10321-PA 1..159 1..157 518 68.6 Plus
Dsim\GD25509-PA 158 GD25509-PA 9..158 8..157 471 60.7 Plus
Dsim\GD22230-PA 191 GD22230-PA 35..187 6..156 443 61.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11291-PA 159 GJ11291-PA 5..159 3..157 573 75.5 Plus
Dvir\GJ11292-PA 159 GJ11292-PA 8..159 7..158 567 73.7 Plus
Dvir\GJ20880-PA 158 GJ20880-PA 1..158 2..157 533 70.9 Plus
Dvir\GJ11943-PA 179 GJ11943-PA 28..177 10..157 479 66 Plus
Dvir\GJ24692-PA 212 GJ24692-PA 45..205 10..157 183 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17171-PA 160 GK17171-PA 9..160 7..158 593 78.9 Plus
Dwil\GK17170-PA 160 GK17170-PA 10..160 7..157 564 76.2 Plus
Dwil\GK19648-PA 159 GK19648-PA 1..159 1..157 522 69.2 Plus
Dwil\GK18316-PA 184 GK18316-PA 32..180 10..156 469 65.1 Plus
Dwil\GK22034-PA 160 GK22034-PA 11..160 8..157 459 64 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21813-PA 158 GE21813-PA 1..158 1..158 704 89.9 Plus
Dyak\GE21812-PA 158 GE21812-PA 8..158 7..157 564 75.5 Plus
Dyak\Vha16-PA 159 GE24687-PA 1..159 1..157 518 68.6 Plus
Dyak\GE14233-PA 158 GE14233-PA 9..158 8..157 469 60 Plus
Dyak\GE13384-PA 191 GE13384-PA 34..187 5..156 410 62.3 Plus