Clone IP04910 Report

Search the DGRC for IP04910

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:49
Well:10
Vector:pOT2
Associated Gene/TranscriptCG32551-RB
Protein status:IP04910.pep: validated not full length
Preliminary Size:456
Sequenced Size:382

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32551 2005-01-01 Successful iPCR screen
CG32551 2008-04-29 Release 5.5 accounting
CG32551 2008-08-15 Release 5.9 accounting
CG32551 2008-12-18 5.12 accounting

Clone Sequence Records

IP04910.complete Sequence

382 bp (382 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022241

> IP04910.complete
ATTTCCGGACCCAGATTCTCTGCCCTACTAATCGTGGCCCTGACCCTCGC
TCTGGTGGCCCAAACTTGGGCCGACGAGTTCGATCTGGACTACTCCAACG
AGTACGACGATGTGCGACCGCATTTGGTCTATCCCGACGATCCAAGGCTG
GACAAGCGGATCGGCGATGCGGCGCGGGAGTTTGGACAAAATATAACCCA
AGCCTGGAACGCGATGGTGGACTCGTTTAAGAACTACTTTGAGGAACTCA
AGAACCTTTTCTCCGACACCACGGATCTCGATTCACCCAATGAAGTATTT
TCTAACCGCTGAAATGGGCGTTTTACTTTCGTTTCGAGCAAATAAAGCGT
AGCAAAGAATTTAAAAAAAAAAAAAAAAAAAA

IP04910.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG32551-RB 397 CG32551-RB 32..397 1..366 1830 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18328069..18328426 3..362 1705 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18438899..18439264 1..366 1830 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18446997..18447362 1..366 1830 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:51:07 has no hits.

IP04910.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:52:10 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18328067..18328426 1..362 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:40 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 4..315 1..312 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:44 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 4..315 1..312 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:00:47 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 4..315 1..312 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:45 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 4..315 1..312 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:05:00 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 4..315 1..312 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:54 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 32..393 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:43 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 32..393 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:00:47 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 32..393 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:45 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 32..393 1..362 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:05:00 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
CG32551-RB 32..393 1..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:10 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
X 18438899..18439260 1..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:10 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
X 18438899..18439260 1..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:52:10 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
X 18438899..18439260 1..362 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:00:47 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18332932..18333293 1..362 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:01:38 Download gff for IP04910.complete
Subject Subject Range Query Range Percent Splice Strand
X 18446997..18447358 1..362 100   Plus

IP04910.pep Sequence

Translation from 0 to 311

> IP04910.pep
ISGPRFSALLIVALTLALVAQTWADEFDLDYSNEYDDVRPHLVYPDDPRL
DKRIGDAAREFGQNITQAWNAMVDSFKNYFEELKNLFSDTTDLDSPNEVF
SNR*

IP04910.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22439-PA 198 GF22439-PA 32..110 21..98 322 74.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19167-PA 104 GG19167-PA 3..101 2..100 402 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12428-PA 103 GH12428-PA 11..93 10..92 271 56.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32551-PB 104 CG32551-PB 2..104 1..103 541 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15016-PA 103 GI15016-PA 2..93 1..92 232 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26975-PA 105 GL26975-PA 1..102 6..101 279 53.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16982-PA 105 GA16982-PA 1..102 6..101 280 54.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22900-PA 151 GM22900-PA 3..99 2..98 429 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17396-PA 151 GD17396-PA 3..99 2..98 426 95.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15369-PA 103 GJ15369-PA 11..103 10..102 237 45.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25263-PA 114 GK25263-PA 3..96 2..96 305 59.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17729-PA 151 GE17729-PA 2..100 1..98 448 87.9 Plus

IP04910.hyp Sequence

Translation from 0 to 311

> IP04910.hyp
ISGPRFSALLIVALTLALVAQTWADEFDLDYSNEYDDVRPHLVYPDDPRL
DKRIGDAAREFGQNITQAWNAMVDSFKNYFEELKNLFSDTTDLDSPNEVF
SNR*

IP04910.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32551-PB 104 CG32551-PB 2..104 1..103 541 100 Plus