BDGP Sequence Production Resources |
Search the DGRC for IP04910
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 49 |
Well: | 10 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32551-RB |
Protein status: | IP04910.pep: validated not full length |
Preliminary Size: | 456 |
Sequenced Size: | 382 |
Gene | Date | Evidence |
---|---|---|
CG32551 | 2005-01-01 | Successful iPCR screen |
CG32551 | 2008-04-29 | Release 5.5 accounting |
CG32551 | 2008-08-15 | Release 5.9 accounting |
CG32551 | 2008-12-18 | 5.12 accounting |
382 bp (382 high quality bases) assembled on 2005-03-06
GenBank Submission: BT022241
> IP04910.complete ATTTCCGGACCCAGATTCTCTGCCCTACTAATCGTGGCCCTGACCCTCGC TCTGGTGGCCCAAACTTGGGCCGACGAGTTCGATCTGGACTACTCCAACG AGTACGACGATGTGCGACCGCATTTGGTCTATCCCGACGATCCAAGGCTG GACAAGCGGATCGGCGATGCGGCGCGGGAGTTTGGACAAAATATAACCCA AGCCTGGAACGCGATGGTGGACTCGTTTAAGAACTACTTTGAGGAACTCA AGAACCTTTTCTCCGACACCACGGATCTCGATTCACCCAATGAAGTATTT TCTAACCGCTGAAATGGGCGTTTTACTTTCGTTTCGAGCAAATAAAGCGT AGCAAAGAATTTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32551-RB | 397 | CG32551-RB | 32..397 | 1..366 | 1830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 18328069..18328426 | 3..362 | 1705 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 18438899..18439264 | 1..366 | 1830 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 18446997..18447362 | 1..366 | 1830 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 18328067..18328426 | 1..362 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 4..315 | 1..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 4..315 | 1..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 4..315 | 1..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 4..315 | 1..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 4..315 | 1..312 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 32..393 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 32..393 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 32..393 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 32..393 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32551-RB | 32..393 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 18438899..18439260 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 18438899..18439260 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 18438899..18439260 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 18332932..18333293 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 18446997..18447358 | 1..362 | 100 | Plus |
Translation from 0 to 311
> IP04910.pep ISGPRFSALLIVALTLALVAQTWADEFDLDYSNEYDDVRPHLVYPDDPRL DKRIGDAAREFGQNITQAWNAMVDSFKNYFEELKNLFSDTTDLDSPNEVF SNR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22439-PA | 198 | GF22439-PA | 32..110 | 21..98 | 322 | 74.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19167-PA | 104 | GG19167-PA | 3..101 | 2..100 | 402 | 87.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH12428-PA | 103 | GH12428-PA | 11..93 | 10..92 | 271 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32551-PB | 104 | CG32551-PB | 2..104 | 1..103 | 541 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15016-PA | 103 | GI15016-PA | 2..93 | 1..92 | 232 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26975-PA | 105 | GL26975-PA | 1..102 | 6..101 | 279 | 53.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16982-PA | 105 | GA16982-PA | 1..102 | 6..101 | 280 | 54.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22900-PA | 151 | GM22900-PA | 3..99 | 2..98 | 429 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17396-PA | 151 | GD17396-PA | 3..99 | 2..98 | 426 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15369-PA | 103 | GJ15369-PA | 11..103 | 10..102 | 237 | 45.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25263-PA | 114 | GK25263-PA | 3..96 | 2..96 | 305 | 59.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17729-PA | 151 | GE17729-PA | 2..100 | 1..98 | 448 | 87.9 | Plus |
Translation from 0 to 311
> IP04910.hyp ISGPRFSALLIVALTLALVAQTWADEFDLDYSNEYDDVRPHLVYPDDPRL DKRIGDAAREFGQNITQAWNAMVDSFKNYFEELKNLFSDTTDLDSPNEVF SNR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32551-PB | 104 | CG32551-PB | 2..104 | 1..103 | 541 | 100 | Plus |