IP04911.complete Sequence
556 bp (556 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023655
> IP04911.complete
CAAAAATGGGATATTATCTGAAGCACGTGATGACTGGATATCGCGTTTAC
CTGAACACTGGTATTCATTTACTGGGAAAGAGCGGAGCTTGCAATGTGGT
ACTAACCTACGACAATATGTCCGATATCCATGCCGTCGTTGTTGTTCGAA
ATGGGAGGATTTTCATTAAAGACCTGGAATCCATCCATGGCATATATCTT
AACTTCAAGGAACACCGCCTTGGCTCTGAGTTTTATGAAATTTTCGTGGG
CGACGATGTGGCCTTTGGGGTTGCAACATTCGGACAGGAACTGGGCACTC
CGCTTACGTACGGATGCTTTACCGTTAGGTCGGAGGATTCAGATTTTGAT
CTAGACTTCTCCGATTCTGAGGACGGCTTCTTCGATTTCGATGACGACGA
CAGCGACCAGTTCTATGGGATCAACGAGAACGAGGAGCCACCCAGTTCCA
CATAAAACAAGTGCAGGACAAAACGCTATGCCGACAAAATGTGATCATCA
TAGGTATAGGTAGCCTTTTTAACTAAATATACTAAACGAAAAAAAAAAAA
AAAAAA
IP04911.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:50:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32595-RA | 639 | CG32595-RA | 84..625 | 1..542 | 2695 | 99.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:45:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 14608574..14608936 | 538..176 | 1815 | 100 | Minus |
chrX | 22417052 | chrX | 14608994..14609170 | 177..1 | 885 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:45:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 14718269..14718635 | 542..176 | 1820 | 99.7 | Minus |
X | 23542271 | X | 14718693..14718869 | 177..1 | 885 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 14726367..14726733 | 542..176 | 1820 | 99.7 | Minus |
X | 23527363 | X | 14726791..14726967 | 177..1 | 885 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 23:45:13 has no hits.
IP04911.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:46:18 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 14608574..14608935 | 177..538 | 100 | <- | Minus |
chrX | 14608995..14609170 | 1..176 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:41 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 1..450 | 6..455 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:33 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 1..450 | 6..455 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:12 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 1..450 | 6..455 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:34 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 1..450 | 6..455 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:55 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
hog-RA | 1..450 | 6..455 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:38 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 1..450 | 6..455 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:32 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 74..611 | 1..538 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:12 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 74..611 | 1..538 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:34 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32595-RA | 1..450 | 6..455 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:55 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
hog-RA | 74..611 | 1..538 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:18 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 14718273..14718634 | 177..538 | 99 | <- | Minus |
X | 14718694..14718869 | 1..176 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:18 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 14718273..14718634 | 177..538 | 99 | <- | Minus |
X | 14718694..14718869 | 1..176 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:18 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 14718273..14718634 | 177..538 | 99 | <- | Minus |
X | 14718694..14718869 | 1..176 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:12 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 14612306..14612667 | 177..538 | 99 | <- | Minus |
arm_X | 14612727..14612902 | 1..176 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:37 Download gff for
IP04911.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 14726371..14726732 | 177..538 | 99 | <- | Minus |
X | 14726792..14726967 | 1..176 | 100 | | Minus |
IP04911.hyp Sequence
Translation from 2 to 454
> IP04911.hyp
KMGYYLKHVMTGYRVYLNTGIHLLGKSGACNVVLTYDNMSDIHAVVVVRN
GRIFIKDLESIHGIYLNFKEHRLGSEFYEIFVGDDVAFGVATFGQELGTP
LTYGCFTVRSEDSDFDLDFSDSEDGFFDFDDDDSDQFYGINENEEPPSST
*
IP04911.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
hog-PA | 149 | CG32595-PA | 1..149 | 2..150 | 798 | 100 | Plus |
CG34323-PA | 112 | CG34323-PA | 1..110 | 2..110 | 246 | 47.3 | Plus |
IP04911.pep Sequence
Translation from 5 to 454
> IP04911.pep
MGYYLKHVMTGYRVYLNTGIHLLGKSGACNVVLTYDNMSDIHAVVVVRNG
RIFIKDLESIHGIYLNFKEHRLGSEFYEIFVGDDVAFGVATFGQELGTPL
TYGCFTVRSEDSDFDLDFSDSEDGFFDFDDDDSDQFYGINENEEPPSST*
IP04911.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:39:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19383-PA | 160 | GF19383-PA | 1..111 | 1..112 | 270 | 45.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:39:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG17709-PA | 134 | GG17709-PA | 1..117 | 1..116 | 275 | 41.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
hog-PA | 149 | CG32595-PA | 1..149 | 1..149 | 798 | 100 | Plus |
CG34323-PA | 112 | CG34323-PA | 1..110 | 1..109 | 246 | 47.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:39:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26696-PA | 1042 | GA26696-PA | 4..67 | 3..66 | 146 | 40.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13259-PA | 116 | GM13259-PA | 1..110 | 1..109 | 221 | 44.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:39:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15843-PA | 168 | GD15843-PA | 1..130 | 1..130 | 427 | 63.1 | Plus |
Dsim\GD17065-PA | 121 | GD17065-PA | 1..110 | 1..109 | 217 | 43.6 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:39:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ12221-PA | 1858 | GJ12221-PA | 8..130 | 3..135 | 147 | 29.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16495-PA | 137 | GE16495-PA | 1..112 | 1..111 | 284 | 43.8 | Plus |