Clone IP04911 Report

Search the DGRC for IP04911

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:49
Well:11
Vector:pOT2
Associated Gene/Transcripthog-RA
Protein status:IP04911.pep: gold
Preliminary Size:450
Sequenced Size:556

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32595 2005-01-01 Successful iPCR screen
CG32595 2008-04-29 Release 5.5 accounting
CG32595 2008-08-15 Release 5.9 accounting
CG32595 2008-12-18 5.12 accounting

Clone Sequence Records

IP04911.complete Sequence

556 bp (556 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023655

> IP04911.complete
CAAAAATGGGATATTATCTGAAGCACGTGATGACTGGATATCGCGTTTAC
CTGAACACTGGTATTCATTTACTGGGAAAGAGCGGAGCTTGCAATGTGGT
ACTAACCTACGACAATATGTCCGATATCCATGCCGTCGTTGTTGTTCGAA
ATGGGAGGATTTTCATTAAAGACCTGGAATCCATCCATGGCATATATCTT
AACTTCAAGGAACACCGCCTTGGCTCTGAGTTTTATGAAATTTTCGTGGG
CGACGATGTGGCCTTTGGGGTTGCAACATTCGGACAGGAACTGGGCACTC
CGCTTACGTACGGATGCTTTACCGTTAGGTCGGAGGATTCAGATTTTGAT
CTAGACTTCTCCGATTCTGAGGACGGCTTCTTCGATTTCGATGACGACGA
CAGCGACCAGTTCTATGGGATCAACGAGAACGAGGAGCCACCCAGTTCCA
CATAAAACAAGTGCAGGACAAAACGCTATGCCGACAAAATGTGATCATCA
TAGGTATAGGTAGCCTTTTTAACTAAATATACTAAACGAAAAAAAAAAAA
AAAAAA

IP04911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG32595-RA 639 CG32595-RA 84..625 1..542 2695 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 14608574..14608936 538..176 1815 100 Minus
chrX 22417052 chrX 14608994..14609170 177..1 885 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 14718269..14718635 542..176 1820 99.7 Minus
X 23542271 X 14718693..14718869 177..1 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 14726367..14726733 542..176 1820 99.7 Minus
X 23527363 X 14726791..14726967 177..1 885 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:45:13 has no hits.

IP04911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:46:18 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 14608574..14608935 177..538 100 <- Minus
chrX 14608995..14609170 1..176 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:41 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 1..450 6..455 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:33 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 1..450 6..455 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:12 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 1..450 6..455 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:34 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 1..450 6..455 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:57:55 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
hog-RA 1..450 6..455 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:38 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 1..450 6..455 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:32 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 74..611 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:12 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 74..611 1..538 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:34 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
CG32595-RA 1..450 6..455 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:57:55 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
hog-RA 74..611 1..538 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:18 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
X 14718273..14718634 177..538 99 <- Minus
X 14718694..14718869 1..176 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:18 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
X 14718273..14718634 177..538 99 <- Minus
X 14718694..14718869 1..176 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:46:18 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
X 14718273..14718634 177..538 99 <- Minus
X 14718694..14718869 1..176 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:12 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 14612306..14612667 177..538 99 <- Minus
arm_X 14612727..14612902 1..176 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:37 Download gff for IP04911.complete
Subject Subject Range Query Range Percent Splice Strand
X 14726371..14726732 177..538 99 <- Minus
X 14726792..14726967 1..176 100   Minus

IP04911.hyp Sequence

Translation from 2 to 454

> IP04911.hyp
KMGYYLKHVMTGYRVYLNTGIHLLGKSGACNVVLTYDNMSDIHAVVVVRN
GRIFIKDLESIHGIYLNFKEHRLGSEFYEIFVGDDVAFGVATFGQELGTP
LTYGCFTVRSEDSDFDLDFSDSEDGFFDFDDDDSDQFYGINENEEPPSST
*

IP04911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
hog-PA 149 CG32595-PA 1..149 2..150 798 100 Plus
CG34323-PA 112 CG34323-PA 1..110 2..110 246 47.3 Plus

IP04911.pep Sequence

Translation from 5 to 454

> IP04911.pep
MGYYLKHVMTGYRVYLNTGIHLLGKSGACNVVLTYDNMSDIHAVVVVRNG
RIFIKDLESIHGIYLNFKEHRLGSEFYEIFVGDDVAFGVATFGQELGTPL
TYGCFTVRSEDSDFDLDFSDSEDGFFDFDDDDSDQFYGINENEEPPSST*

IP04911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19383-PA 160 GF19383-PA 1..111 1..112 270 45.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17709-PA 134 GG17709-PA 1..117 1..116 275 41.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
hog-PA 149 CG32595-PA 1..149 1..149 798 100 Plus
CG34323-PA 112 CG34323-PA 1..110 1..109 246 47.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26696-PA 1042 GA26696-PA 4..67 3..66 146 40.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13259-PA 116 GM13259-PA 1..110 1..109 221 44.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15843-PA 168 GD15843-PA 1..130 1..130 427 63.1 Plus
Dsim\GD17065-PA 121 GD17065-PA 1..110 1..109 217 43.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12221-PA 1858 GJ12221-PA 8..130 3..135 147 29.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16495-PA 137 GE16495-PA 1..112 1..111 284 43.8 Plus