Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP04953.complete Sequence
676 bp (676 high quality bases) assembled on 2005-03-06
GenBank Submission: BT022233
> IP04953.complete
GAGCCGATACTCCATGAAAGGCATCAATTTCGATGTTAAACGCGATATAC
AAAAGGTGGATGCTCGCACCTACGGATTCCTGAAGACCAAGGGATCAGAT
ACGCCGATGCCCACGGCTGCGAAGAGAATTAATCAATCGACGTTGATCGA
AAGATTGAAATCCATAACATTGGCTGAAGTGGTGGACGAGGAAGATCAGT
CGTCTACGGGTTCAGTGGAATCGGGTAGCATGTCCTTCGAAATGAAACGG
AAGCTATTTGACGCAGCCGAGTTCACCATCACCCGAGGTCAGAAACTGAG
TGACCTCACGCATGCCGCTGATGAGGGGATTAACTTTAGTCCGTACGATA
CCGGCAACAAGACACTCGAAGAAATCGAGGAATACTGCCGCGCCGTCAAC
ATTAAGTTTGCCAAATGAAAGGATAAACTCTTCCAGAGATTTTACACGAT
ATATATACGATGGAATTCGGTGGATAAAAGATGAAACGGAGCAGGGATCA
CCTGTAAAGGAATCAGGTCTAGATTCAATATAATCAAAGCAAATCAAAGA
AACTATTTTATAAAGCTAAGTTCACTATAGAACAAAGGCAAAAATGGACT
GGATATATTTTATATTTCGCATACCTAAAGATTACAATAATAAAAAATAT
TCTCACATTAAAAAAAAAAAAAAAAA
IP04953.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:49:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5509-RA | 466 | CG5509-RA | 52..466 | 4..418 | 2075 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:39:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 8277914..8278569 | 4..659 | 3250 | 99.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:39:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 12452541..12453198 | 4..661 | 3290 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 12193372..12194029 | 4..661 | 3290 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 19:39:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ivk | 5402 | Ivk IVK 5402bp | 3642..3675 | 626..659 | 107 | 79.4 | Plus |
IP04953.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:40:26 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 8277911..8278569 | 1..659 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:46 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 3..420 | 1..418 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:22 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 3..420 | 1..418 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:40 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 3..420 | 1..418 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:25 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 3..420 | 1..418 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:10 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 3..420 | 1..418 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:20:50 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 49..466 | 1..418 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:22 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 75..733 | 1..659 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:40 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 75..733 | 1..659 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:25 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 49..466 | 1..418 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:10 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5509-RA | 75..733 | 1..659 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:26 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12452538..12453196 | 1..659 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:26 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12452538..12453196 | 1..659 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:26 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12452538..12453196 | 1..659 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:40 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8278260..8278918 | 1..659 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:36 Download gff for
IP04953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12193369..12194027 | 1..659 | 99 | | Plus |
IP04953.hyp Sequence
Translation from 0 to 417
> IP04953.hyp
SRYSMKGINFDVKRDIQKVDARTYGFLKTKGSDTPMPTAAKRINQSTLIE
RLKSITLAEVVDEEDQSSTGSVESGSMSFEMKRKLFDAAEFTITRGQKLS
DLTHAADEGINFSPYDTGNKTLEEIEEYCRAVNIKFAK*
IP04953.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5509-PA | 139 | CG5509-PA | 2..139 | 1..138 | 695 | 100 | Plus |
I-t-PA | 184 | CG14719-PA | 47..180 | 22..138 | 167 | 32.8 | Plus |
IP04953.pep Sequence
Translation from 1 to 417
> IP04953.pep
SRYSMKGINFDVKRDIQKVDARTYGFLKTKGSDTPMPTAAKRINQSTLIE
RLKSITLAEVVDEEDQSSTGSVESGSMSFEMKRKLFDAAEFTITRGQKLS
DLTHAADEGINFSPYDTGNKTLEEIEEYCRAVNIKFAK*
IP04953.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:39:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18394-PA | 168 | GF18394-PA | 29..166 | 22..136 | 140 | 28.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:39:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18388-PA | 172 | GG18388-PA | 39..171 | 22..136 | 154 | 33.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5509-PA | 139 | CG5509-PA | 2..139 | 1..138 | 695 | 100 | Plus |
I-t-PA | 184 | CG14719-PA | 47..180 | 22..138 | 167 | 32.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:39:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA30219-PA | 184 | GA30219-PA | 39..177 | 22..138 | 189 | 35.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:39:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23973-PA | 185 | GM23973-PA | 47..181 | 22..138 | 169 | 32.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:39:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18778-PA | 185 | GD18778-PA | 47..181 | 22..138 | 164 | 33.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:39:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK18127-PA | 175 | GK18127-PA | 16..168 | 19..138 | 177 | 30.8 | Plus |
Dwil\GK11099-PA | 208 | GK11099-PA | 41..196 | 22..136 | 152 | 30.8 | Plus |
Dwil\GK11992-PA | 229 | GK11992-PA | 67..225 | 22..138 | 139 | 26.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:39:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24197-PA | 167 | GE24197-PA | 39..166 | 22..136 | 163 | 34.4 | Plus |