Clone IP04953 Report

Search the DGRC for IP04953

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:49
Well:53
Vector:pOT2
Associated Gene/TranscriptCG5509-RA
Protein status:IP04953.pep: validated not full length
Preliminary Size:466
Sequenced Size:676

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5509 2005-01-01 Successful iPCR screen
CG5509 2008-04-29 Release 5.5 accounting
CG5509 2008-08-15 Release 5.9 accounting
CG5509 2008-12-18 5.12 accounting

Clone Sequence Records

IP04953.complete Sequence

676 bp (676 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022233

> IP04953.complete
GAGCCGATACTCCATGAAAGGCATCAATTTCGATGTTAAACGCGATATAC
AAAAGGTGGATGCTCGCACCTACGGATTCCTGAAGACCAAGGGATCAGAT
ACGCCGATGCCCACGGCTGCGAAGAGAATTAATCAATCGACGTTGATCGA
AAGATTGAAATCCATAACATTGGCTGAAGTGGTGGACGAGGAAGATCAGT
CGTCTACGGGTTCAGTGGAATCGGGTAGCATGTCCTTCGAAATGAAACGG
AAGCTATTTGACGCAGCCGAGTTCACCATCACCCGAGGTCAGAAACTGAG
TGACCTCACGCATGCCGCTGATGAGGGGATTAACTTTAGTCCGTACGATA
CCGGCAACAAGACACTCGAAGAAATCGAGGAATACTGCCGCGCCGTCAAC
ATTAAGTTTGCCAAATGAAAGGATAAACTCTTCCAGAGATTTTACACGAT
ATATATACGATGGAATTCGGTGGATAAAAGATGAAACGGAGCAGGGATCA
CCTGTAAAGGAATCAGGTCTAGATTCAATATAATCAAAGCAAATCAAAGA
AACTATTTTATAAAGCTAAGTTCACTATAGAACAAAGGCAAAAATGGACT
GGATATATTTTATATTTCGCATACCTAAAGATTACAATAATAAAAAATAT
TCTCACATTAAAAAAAAAAAAAAAAA

IP04953.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5509-RA 466 CG5509-RA 52..466 4..418 2075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8277914..8278569 4..659 3250 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12452541..12453198 4..661 3290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12193372..12194029 4..661 3290 100 Plus
Blast to na_te.dros performed 2019-03-15 19:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 3642..3675 626..659 107 79.4 Plus

IP04953.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:40:26 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8277911..8278569 1..659 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:46 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 3..420 1..418 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:22 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 3..420 1..418 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:40 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 3..420 1..418 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:25 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 3..420 1..418 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:10 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 3..420 1..418 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:20:50 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 49..466 1..418 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:22 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 75..733 1..659 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:40 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 75..733 1..659 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:25 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 49..466 1..418 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:10 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
CG5509-RA 75..733 1..659 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:26 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12452538..12453196 1..659 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:26 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12452538..12453196 1..659 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:26 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12452538..12453196 1..659 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:40 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8278260..8278918 1..659 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:36 Download gff for IP04953.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12193369..12194027 1..659 99   Plus

IP04953.hyp Sequence

Translation from 0 to 417

> IP04953.hyp
SRYSMKGINFDVKRDIQKVDARTYGFLKTKGSDTPMPTAAKRINQSTLIE
RLKSITLAEVVDEEDQSSTGSVESGSMSFEMKRKLFDAAEFTITRGQKLS
DLTHAADEGINFSPYDTGNKTLEEIEEYCRAVNIKFAK*

IP04953.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5509-PA 139 CG5509-PA 2..139 1..138 695 100 Plus
I-t-PA 184 CG14719-PA 47..180 22..138 167 32.8 Plus

IP04953.pep Sequence

Translation from 1 to 417

> IP04953.pep
SRYSMKGINFDVKRDIQKVDARTYGFLKTKGSDTPMPTAAKRINQSTLIE
RLKSITLAEVVDEEDQSSTGSVESGSMSFEMKRKLFDAAEFTITRGQKLS
DLTHAADEGINFSPYDTGNKTLEEIEEYCRAVNIKFAK*

IP04953.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18394-PA 168 GF18394-PA 29..166 22..136 140 28.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18388-PA 172 GG18388-PA 39..171 22..136 154 33.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5509-PA 139 CG5509-PA 2..139 1..138 695 100 Plus
I-t-PA 184 CG14719-PA 47..180 22..138 167 32.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30219-PA 184 GA30219-PA 39..177 22..138 189 35.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23973-PA 185 GM23973-PA 47..181 22..138 169 32.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18778-PA 185 GD18778-PA 47..181 22..138 164 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18127-PA 175 GK18127-PA 16..168 19..138 177 30.8 Plus
Dwil\GK11099-PA 208 GK11099-PA 41..196 22..136 152 30.8 Plus
Dwil\GK11992-PA 229 GK11992-PA 67..225 22..138 139 26.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24197-PA 167 GE24197-PA 39..166 22..136 163 34.4 Plus