Clone IP04957 Report

Search the DGRC for IP04957

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:49
Well:57
Vector:pOT2
Associated Gene/TranscriptCG7211-RA
Protein status:IP04957.pep: gold
Preliminary Size:479
Sequenced Size:531

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7211 2005-01-01 Successful iPCR screen
CG7211 2008-04-29 Release 5.5 accounting
CG7211 2008-08-15 Release 5.9 accounting
CG7211 2008-12-18 5.12 accounting

Clone Sequence Records

IP04957.complete Sequence

531 bp (531 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023653

> IP04957.complete
CTTTGTACGAGAACGTAAAATTGTCGAATTTTTAGAAACTTGCATTTCTT
GTTTTATTTTTCTACCAACAAAATGAGTCAATTGATTGCCAAGGCAAAGA
CCCTAGTAAACAAAATGATTGTGGCAGCACGTCCGCAGCTCGATGAATTC
TGGAAGTATGCCAAGGTGGAGCTATCACCGCCGCTGCCCGCTGATTTCCA
AAAGCTGAAGCAGACCGCTGAGTCCGCCAAGTTGGCCTCCAAAAAGGATA
TGAAGGGGCAGCTAAAGAAGTCCGGACTTTCCCAAGTGACAGTCGCTGAG
GCCTGGCTAAATGTTCTGGTCACCGTGGAGGTGATTACCTGGTTCTACAT
GGGCGAGGTTATCGGTCGTCGTCACCTGGTCGGCTACAAGGTTTAGACAT
AGCAGATTTAATATTCTCCTTATGTTTTTGTGTTGTATGCAAATGGCCCA
GTGCATTTAAGCCCTTTTTCTGTGGCCAGGTGCACTGAATAAAGGTGCAT
TATCAAGCATTACAAAAAAAAAAAAAAAAAA

IP04957.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7211-RA 642 CG7211-RA 113..627 1..515 2575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7746572..7746972 113..513 1990 99.8 Plus
chr2L 23010047 chr2L 7746407..7746518 1..112 560 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7747474..7747876 113..515 2015 100 Plus
2L 23513712 2L 7747309..7747420 1..112 560 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7747474..7747876 113..515 2015 100 Plus
2L 23513712 2L 7747309..7747420 1..112 560 100 Plus
Blast to na_te.dros performed 2019-03-15 15:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 2745..2784 391..430 110 75 Plus

IP04957.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:35:30 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7746407..7746518 1..112 100 -> Plus
chr2L 7746572..7746972 113..513 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:47 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..324 73..396 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:02 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..324 73..396 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:32:37 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..324 73..396 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:40 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..324 73..396 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:09:45 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..324 73..396 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:19 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..479 35..513 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:02 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..479 35..513 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:32:37 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 35..547 1..513 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:40 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 1..479 35..513 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:09:45 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
CG7211-RA 35..547 1..513 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:30 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7747309..7747420 1..112 100 -> Plus
2L 7747474..7747874 113..513 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:30 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7747309..7747420 1..112 100 -> Plus
2L 7747474..7747874 113..513 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:35:30 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7747309..7747420 1..112 100 -> Plus
2L 7747474..7747874 113..513 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:32:37 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7747309..7747420 1..112 100 -> Plus
arm_2L 7747474..7747874 113..513 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:38 Download gff for IP04957.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7747474..7747874 113..513 100   Plus
2L 7747309..7747420 1..112 100 -> Plus

IP04957.hyp Sequence

Translation from 72 to 395

> IP04957.hyp
MSQLIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPADFQKLKQTAE
SAKLASKKDMKGQLKKSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRR
HLVGYKV*

IP04957.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7211-PA 107 CG7211-PA 1..107 1..107 538 100 Plus
l(2)06225-PD 99 CG6105-PD 1..99 1..107 261 51.4 Plus
l(2)06225-PB 99 CG6105-PB 1..99 1..107 261 51.4 Plus
l(2)06225-PA 99 CG6105-PA 1..99 1..107 261 51.4 Plus

IP04957.pep Sequence

Translation from 72 to 395

> IP04957.pep
MSQLIAKAKTLVNKMIVAARPQLDEFWKYAKVELSPPLPADFQKLKQTAE
SAKLASKKDMKGQLKKSGLSQVTVAEAWLNVLVTVEVITWFYMGEVIGRR
HLVGYKV*

IP04957.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15319-PA 109 GF15319-PA 1..109 1..107 389 67 Plus
Dana\GF14048-PA 99 GF14048-PA 1..99 1..107 273 51.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10491-PA 107 GG10491-PA 1..107 1..107 531 95.3 Plus
Dere\GG10338-PA 99 GG10338-PA 1..99 1..107 272 51.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11258-PA 101 GH11258-PA 1..101 1..107 365 66.4 Plus
Dgri\GH10969-PA 99 GH10969-PA 1..99 1..107 274 48.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynGL-PA 107 CG7211-PA 1..107 1..107 538 100 Plus
ATPsynG-PD 99 CG6105-PD 1..99 1..107 261 51.4 Plus
ATPsynG-PB 99 CG6105-PB 1..99 1..107 261 51.4 Plus
ATPsynG-PA 99 CG6105-PA 1..99 1..107 261 51.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18153-PA 99 GI18153-PA 1..99 1..107 279 51.4 Plus
Dmoj\GI21888-PA 97 GI21888-PA 1..97 1..107 259 53.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19281-PA 104 GL19281-PA 1..104 1..107 344 70.1 Plus
Dper\GL19020-PA 99 GL19020-PA 1..99 1..107 279 50.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20182-PA 104 GA20182-PA 1..104 1..107 342 69.2 Plus
Dpse\GA19355-PA 99 GA19355-PA 1..99 1..107 279 50.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16543-PA 107 GM16543-PA 1..107 1..107 530 95.3 Plus
Dsec\GM11242-PA 99 GM11242-PA 1..99 1..107 273 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23483-PA 107 GD23483-PA 1..107 1..107 539 96.3 Plus
Dsim\GD22207-PA 99 GD22207-PA 1..99 1..107 273 51.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17810-PA 105 GJ17810-PA 1..105 1..107 369 64.5 Plus
Dvir\GJ14568-PA 99 GJ14568-PA 1..99 1..107 278 49.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24404-PA 105 GK24404-PA 1..105 1..107 375 65.4 Plus
Dwil\GK15246-PA 98 GK15246-PA 4..98 5..107 268 50.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14603-PA 107 GE14603-PA 1..107 1..107 521 93.5 Plus
Dyak\l(2)06225-PA 99 GE13121-PA 1..99 1..107 273 51.4 Plus