IP04962.complete Sequence
469 bp (469 high quality bases) assembled on 2006-01-24
GenBank Submission: BT024402
> IP04962.complete
CCCCAATGCATTTGATTAAGATCGCCTTGTTACTAAGCTTTTTGGCTTTA
TGCCAAAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTA
TCTGCGATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTAATGATCGAGA
ACTCTATAACGGCCATAAGCCTCCTATCCGATTGCGTTGATTTTCAGCCG
AAAATCAAACTAACTGGTAGCATTCTCAGATTTATTAGGGTGGCCCATCA
GTTTGGCAAGAAGGCGATATACGATCGACCGGAATGTCTCGTACAAACCT
TTACCACCGGAGTCGGACTGATTAGACCGATTATAGCCAAGTTTGATAGC
TTGAGGTGCTTTGATGAGTAAGACAACCTACCTAGTTTGAATAAATATTC
AGAATATACCGAAAGTTTGCCTGGCCAAGCAAACGGATCAGAAAAAAAAA
AAAAAAAAAAAAAAAAAAA
IP04962.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:20:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14a-RA | 731 | Acp53C14a-RA | 119..561 | 1..443 | 2215 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:45:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 12635283..12635672 | 441..48 | 1815 | 98 | Minus |
chr2R | 21145070 | chr2R | 12635725..12635771 | 47..1 | 235 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16748058..16748453 | 443..48 | 1980 | 100 | Minus |
2R | 25286936 | 2R | 16748506..16748552 | 47..1 | 235 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 16749257..16749652 | 443..48 | 1980 | 100 | Minus |
2R | 25260384 | 2R | 16749705..16749751 | 47..1 | 235 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 09:45:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
transib3 | 2883 | transib3 TRANSIB3 2883bp | 24..52 | 58..30 | 109 | 86.2 | Minus |
IP04962.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:46:54 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 12635283..12635672 | 48..441 | 97 | <- | Minus |
chr2R | 12635725..12635771 | 1..47 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:48 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 1..366 | 6..371 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:06 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 1..366 | 6..371 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:33 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 1..366 | 6..371 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:44 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 1..366 | 6..371 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:07 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 1..366 | 6..371 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:32 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 21..461 | 1..441 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:06 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 21..461 | 1..441 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:33 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 21..461 | 1..441 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:44 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 10..450 | 1..441 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:07 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp53C14a-RA | 39..479 | 1..441 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:54 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16748060..16748453 | 48..441 | 100 | <- | Minus |
2R | 16748506..16748552 | 1..47 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:54 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16748060..16748453 | 48..441 | 100 | <- | Minus |
2R | 16748506..16748552 | 1..47 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:54 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16748060..16748453 | 48..441 | 100 | <- | Minus |
2R | 16748506..16748552 | 1..47 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:33 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 12635565..12635958 | 48..441 | 100 | <- | Minus |
arm_2R | 12636011..12636057 | 1..47 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:39 Download gff for
IP04962.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16749259..16749652 | 48..441 | 100 | <- | Minus |
2R | 16749705..16749751 | 1..47 | 100 | | Minus |
IP04962.hyp Sequence
Translation from 2 to 370
> IP04962.hyp
PMHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIEN
SITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTF
TTGVGLIRPIIAKFDSLRCFDE*
IP04962.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14a-PB | 121 | CG8626-PB | 1..121 | 2..122 | 608 | 100 | Plus |
Acp53C14a-PA | 121 | CG8626-PA | 1..121 | 2..122 | 608 | 100 | Plus |
Acp53Ea-PA | 120 | CG8622-PA | 1..120 | 2..122 | 155 | 28.1 | Plus |
Acp53C14b-PB | 132 | CG15616-PB | 1..127 | 2..122 | 136 | 26.8 | Plus |
Acp53C14b-PA | 132 | CG15616-PA | 1..127 | 2..122 | 136 | 26.8 | Plus |
IP04962.pep Sequence
Translation from 5 to 370
> IP04962.pep
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE*
IP04962.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:18:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13451-PA | 121 | GF13451-PA | 1..121 | 1..121 | 459 | 68.6 | Plus |
Dana\GF13449-PA | 118 | GF13449-PA | 18..118 | 21..121 | 143 | 22.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:18:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG22248-PA | 121 | GG22248-PA | 1..121 | 1..121 | 588 | 92.6 | Plus |
Dere\GG22246-PA | 120 | GG22246-PA | 1..120 | 1..121 | 144 | 24 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp53C14a-PB | 121 | CG8626-PB | 1..121 | 1..121 | 608 | 100 | Plus |
Acp53C14a-PA | 121 | CG8626-PA | 1..121 | 1..121 | 608 | 100 | Plus |
Acp53Ea-PA | 120 | CG8622-PA | 1..120 | 1..121 | 155 | 28.1 | Plus |
Acp53C14b-PB | 132 | CG15616-PB | 1..127 | 1..121 | 136 | 26.8 | Plus |
Acp53C14b-PA | 132 | CG15616-PA | 1..127 | 1..121 | 136 | 26.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:18:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11818-PA | 120 | GL11818-PA | 1..120 | 1..121 | 328 | 54.5 | Plus |
Dper\GL11816-PA | 132 | GL11816-PA | 1..127 | 1..121 | 145 | 28.3 | Plus |
Dper\Acp53Ea-PA | 120 | GL11815-PA | 21..119 | 22..120 | 143 | 27.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:18:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\Acp53C14a-PA | 120 | GA21217-PA | 1..120 | 1..121 | 328 | 54.5 | Plus |
Dpse\Acp53C14b-PA | 132 | GA13850-PA | 1..127 | 1..121 | 145 | 28.3 | Plus |
Dpse\Acp53Ea-PA | 120 | GA21214-PA | 21..119 | 22..120 | 143 | 27.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:18:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20036-PA | 121 | GM20036-PA | 1..121 | 1..121 | 620 | 98.3 | Plus |
Dsec\Acp53Ea-PA | 120 | GM20034-PA | 1..120 | 1..121 | 160 | 28.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:18:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Acp53C14a-PA | 121 | GD25520-PA | 1..121 | 1..121 | 624 | 99.2 | Plus |
Dsim\Acp53Ea-PA | 120 | GD25518-PA | 1..120 | 1..121 | 157 | 28.9 | Plus |
Dsim\Acp53C14b-PA | 132 | GD25519-PA | 1..127 | 1..121 | 131 | 26 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:18:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE14040-PA | 121 | GE14040-PA | 1..121 | 1..121 | 552 | 86 | Plus |
Dyak\Acp53Ea-PA | 120 | GE14038-PA | 1..120 | 1..121 | 133 | 22.3 | Plus |