Clone IP04962 Report

Search the DGRC for IP04962

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:49
Well:62
Vector:pOT2
Associated Gene/TranscriptAcp53C14a-RA
Protein status:IP04962.pep: gold
Preliminary Size:463
Sequenced Size:469

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8626 2005-01-01 Successful iPCR screen
Acp53C14a 2008-04-29 Release 5.5 accounting
Acp53C14a 2008-08-15 Release 5.9 accounting
Acp53C14a 2008-12-18 5.12 accounting

Clone Sequence Records

IP04962.complete Sequence

469 bp (469 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024402

> IP04962.complete
CCCCAATGCATTTGATTAAGATCGCCTTGTTACTAAGCTTTTTGGCTTTA
TGCCAAAAGTCGCAAGTTCAAGCCGCCATAAGTTCGGAACTCGATCACTA
TCTGCGATGTTTGGAAGTGGTGACTGATGCCGGTGCCCTAATGATCGAGA
ACTCTATAACGGCCATAAGCCTCCTATCCGATTGCGTTGATTTTCAGCCG
AAAATCAAACTAACTGGTAGCATTCTCAGATTTATTAGGGTGGCCCATCA
GTTTGGCAAGAAGGCGATATACGATCGACCGGAATGTCTCGTACAAACCT
TTACCACCGGAGTCGGACTGATTAGACCGATTATAGCCAAGTTTGATAGC
TTGAGGTGCTTTGATGAGTAAGACAACCTACCTAGTTTGAATAAATATTC
AGAATATACCGAAAGTTTGCCTGGCCAAGCAAACGGATCAGAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

IP04962.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-RA 731 Acp53C14a-RA 119..561 1..443 2215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12635283..12635672 441..48 1815 98 Minus
chr2R 21145070 chr2R 12635725..12635771 47..1 235 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16748058..16748453 443..48 1980 100 Minus
2R 25286936 2R 16748506..16748552 47..1 235 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16749257..16749652 443..48 1980 100 Minus
2R 25260384 2R 16749705..16749751 47..1 235 100 Minus
Blast to na_te.dros performed 2019-03-16 09:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 24..52 58..30 109 86.2 Minus

IP04962.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:46:54 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12635283..12635672 48..441 97 <- Minus
chr2R 12635725..12635771 1..47 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:48 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 1..366 6..371 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:06 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 1..366 6..371 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:52:33 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 1..366 6..371 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:44 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 1..366 6..371 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:45:07 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 1..366 6..371 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:32 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 21..461 1..441 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:06 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 21..461 1..441 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:33 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 21..461 1..441 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:44 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 10..450 1..441 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:45:07 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
Acp53C14a-RA 39..479 1..441 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:54 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16748060..16748453 48..441 100 <- Minus
2R 16748506..16748552 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:54 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16748060..16748453 48..441 100 <- Minus
2R 16748506..16748552 1..47 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:54 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16748060..16748453 48..441 100 <- Minus
2R 16748506..16748552 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:33 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12635565..12635958 48..441 100 <- Minus
arm_2R 12636011..12636057 1..47 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:39 Download gff for IP04962.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16749259..16749652 48..441 100 <- Minus
2R 16749705..16749751 1..47 100   Minus

IP04962.hyp Sequence

Translation from 2 to 370

> IP04962.hyp
PMHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIEN
SITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTF
TTGVGLIRPIIAKFDSLRCFDE*

IP04962.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-PB 121 CG8626-PB 1..121 2..122 608 100 Plus
Acp53C14a-PA 121 CG8626-PA 1..121 2..122 608 100 Plus
Acp53Ea-PA 120 CG8622-PA 1..120 2..122 155 28.1 Plus
Acp53C14b-PB 132 CG15616-PB 1..127 2..122 136 26.8 Plus
Acp53C14b-PA 132 CG15616-PA 1..127 2..122 136 26.8 Plus

IP04962.pep Sequence

Translation from 5 to 370

> IP04962.pep
MHLIKIALLLSFLALCQKSQVQAAISSELDHYLRCLEVVTDAGALMIENS
ITAISLLSDCVDFQPKIKLTGSILRFIRVAHQFGKKAIYDRPECLVQTFT
TGVGLIRPIIAKFDSLRCFDE*

IP04962.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13451-PA 121 GF13451-PA 1..121 1..121 459 68.6 Plus
Dana\GF13449-PA 118 GF13449-PA 18..118 21..121 143 22.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22248-PA 121 GG22248-PA 1..121 1..121 588 92.6 Plus
Dere\GG22246-PA 120 GG22246-PA 1..120 1..121 144 24 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Acp53C14a-PB 121 CG8626-PB 1..121 1..121 608 100 Plus
Acp53C14a-PA 121 CG8626-PA 1..121 1..121 608 100 Plus
Acp53Ea-PA 120 CG8622-PA 1..120 1..121 155 28.1 Plus
Acp53C14b-PB 132 CG15616-PB 1..127 1..121 136 26.8 Plus
Acp53C14b-PA 132 CG15616-PA 1..127 1..121 136 26.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11818-PA 120 GL11818-PA 1..120 1..121 328 54.5 Plus
Dper\GL11816-PA 132 GL11816-PA 1..127 1..121 145 28.3 Plus
Dper\Acp53Ea-PA 120 GL11815-PA 21..119 22..120 143 27.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Acp53C14a-PA 120 GA21217-PA 1..120 1..121 328 54.5 Plus
Dpse\Acp53C14b-PA 132 GA13850-PA 1..127 1..121 145 28.3 Plus
Dpse\Acp53Ea-PA 120 GA21214-PA 21..119 22..120 143 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20036-PA 121 GM20036-PA 1..121 1..121 620 98.3 Plus
Dsec\Acp53Ea-PA 120 GM20034-PA 1..120 1..121 160 28.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp53C14a-PA 121 GD25520-PA 1..121 1..121 624 99.2 Plus
Dsim\Acp53Ea-PA 120 GD25518-PA 1..120 1..121 157 28.9 Plus
Dsim\Acp53C14b-PA 132 GD25519-PA 1..127 1..121 131 26 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14040-PA 121 GE14040-PA 1..121 1..121 552 86 Plus
Dyak\Acp53Ea-PA 120 GE14038-PA 1..120 1..121 133 22.3 Plus