Clone IP05056 Report

Search the DGRC for IP05056

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:50
Well:56
Vector:pOT2
Associated Gene/TranscriptCpr66Cb-RA
Protein status:IP05056.pep: gold
Preliminary Size:489
Sequenced Size:1018

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7076 2005-01-01 Successful iPCR screen
Cpr66Cb 2008-04-29 Release 5.5 accounting
Cpr66Cb 2008-08-15 Release 5.9 accounting
Cpr66Cb 2008-12-18 5.12 accounting

Clone Sequence Records

IP05056.complete Sequence

1018 bp (1018 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024400

> IP05056.complete
AAAAGTCGTTGCGTGCAGTCAACCAGTGATCTCCAAATAAATCGCGAGCT
AAAACTCAAACTAAAATGGCATTCAAGTATCTGATCTTCGCCTCGGCTCT
GTGCCTGAGCCTCGCCTATCCGTTGGAGCACCAGTACTACGAGGAGAGCC
ATGGATATGAGCACCTGGCCCATCACGAACCGGAGCCCATCCATGAGTAT
GGCCACCATCAAATCGAACGCATCTCACTGGGCGAGGAGCACGGTCACCT
CGAACACGCTGAGCCCCACTACGAGACCCACGAGTCTCACGGACATGATG
AACATGTGGATTACTATGCTCCTCCCAAATATGCTTTCAAGTACGGCGTG
AATGACTTCCACACCGGAGATGTGAAGTCGCAGCACGAGACCCGCGATGG
TGACACCGTCAAGGGACAGTACTCCCTGGTGGAGCCCGATGGTTCCATCC
GCACCGTGGACTACACCGCCGACAAGCACAATGGATTCAACGCCGTGGTC
CACAAGACCGCTCCAGTGCATCATCATGAGGAGCTGCACGAACACCACTA
CTAAGCTAGTACACACTGCGCACTAGAGTTAGCCAAATTGCTCATCAGCC
GGAAGTGGGAGGAGGATTATGAGGACTAGGAGGAGGGACAAGCATATCCA
CATCGGTCGACCATGGAATCAGCTTCATATCTCGTAATTAGGACATCAGC
ACACACCCAGGCCAAGGATCACATCCTGTCCATGGCCATTTCATTAACAT
TTTGTATATTGTATTTTATTCTGTGATAGCGAATAACTTCTATGTGTATC
TTCCGCTTTCAACTGATCCTTAGTCACTACCTGCTCAGACGAATTTACCG
ATCACTACTCGACTGTTTGCCTTAATCTTTAATCTATAATCTATAATCTG
TAAACTGTAATGTATACTTATGTCTTCTCGTAAAACAGAGATCGAACGAA
GAAATTGTAAATTGTGTAATAAAGTGTGAATTATGTACTTTTTATAAAAT
CAAAAAAAAAAAAAAAAA

IP05056.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr66Cb-RA 1122 Cpr66Cb-RA 110..1114 1..1005 5025 100 Plus
Cpr62Bc-RA 1314 Cpr62Bc-RA 422..594 338..510 445 83.8 Plus
CG34461-RA 806 CG34461-RA 436..624 323..511 375 79.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8329953..8330636 318..1001 3390 99.7 Plus
chr3L 24539361 chr3L 8329628..8329870 76..318 1215 100 Plus
chr3L 24539361 chr3L 1840525..1840697 510..338 475 85 Minus
chr3L 24539361 chr3L 8328712..8328788 1..77 385 100 Plus
chr3L 24539361 chr3L 8318894..8318988 417..511 325 89.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:55:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8337912..8338599 318..1005 3440 100 Plus
3L 28110227 3L 8337587..8337829 76..318 1215 100 Plus
3L 28110227 3L 1840995..1841167 510..338 445 83.8 Minus
3L 28110227 3L 8336672..8336748 1..77 385 100 Plus
3L 28110227 3L 8326839..8326933 417..511 325 89.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8331012..8331699 318..1005 3440 100 Plus
3L 28103327 3L 8330687..8330929 76..318 1215 100 Plus
3L 28103327 3L 1840995..1841167 510..338 445 83.8 Minus
3L 28103327 3L 8329772..8329848 1..77 385 100 Plus
3L 28103327 3L 8319939..8320033 417..511 325 89.4 Plus
3L 28103327 3L 1834470..1834526 473..417 180 87.7 Minus
3L 28103327 3L 1834601..1834678 400..323 150 79.4 Minus
Blast to na_te.dros performed 2019-03-16 09:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
Idefix 7411 Idefix DME9736 7411bp Derived from AJ009736 (e1371475) (Rel. 58, Last updated, Version 1). 4146..4265 956..838 119 58.7 Minus
accord2 7650 accord2 QBERT 7650bp 5539..5582 755..799 114 75.6 Plus

IP05056.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:56:09 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8328712..8328788 1..77 100 -> Plus
chr3L 8329630..8329869 78..317 100 -> Plus
chr3L 8329953..8330636 318..1001 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:54 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..489 66..554 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:44 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..489 66..554 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:13 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..489 66..554 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:59 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..489 66..554 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:49:20 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..489 66..554 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:11 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:44 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:13 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:59 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:49:20 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr66Cb-RA 1..1001 1..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:09 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8336672..8336748 1..77 100 -> Plus
3L 8337589..8337828 78..317 100 -> Plus
3L 8337912..8338595 318..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:09 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8336672..8336748 1..77 100 -> Plus
3L 8337589..8337828 78..317 100 -> Plus
3L 8337912..8338595 318..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:09 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8336672..8336748 1..77 100 -> Plus
3L 8337589..8337828 78..317 100 -> Plus
3L 8337912..8338595 318..1001 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:13 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8329772..8329848 1..77 100 -> Plus
arm_3L 8330689..8330928 78..317 100 -> Plus
arm_3L 8331012..8331695 318..1001 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:06 Download gff for IP05056.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8329772..8329848 1..77 100 -> Plus
3L 8330689..8330928 78..317 100 -> Plus
3L 8331012..8331695 318..1001 100   Plus

IP05056.hyp Sequence

Translation from 65 to 553

> IP05056.hyp
MAFKYLIFASALCLSLAYPLEHQYYEESHGYEHLAHHEPEPIHEYGHHQI
ERISLGEEHGHLEHAEPHYETHESHGHDEHVDYYAPPKYAFKYGVNDFHT
GDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGFNAVVHKTAP
VHHHEELHEHHY*

IP05056.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr66Cb-PA 162 CG7076-PA 1..162 1..162 921 100 Plus
Cpr62Bc-PB 180 CG1919-PB 17..119 54..154 349 66.3 Plus
Cpr62Bc-PA 180 CG1919-PA 17..119 54..154 349 66.3 Plus
CG34461-PB 138 CG34461-PB 20..138 58..162 322 58 Plus
CG34461-PA 138 CG34461-PA 20..138 58..162 322 58 Plus

IP05056.pep Sequence

Translation from 65 to 553

> IP05056.pep
MAFKYLIFASALCLSLAYPLEHQYYEESHGYEHLAHHEPEPIHEYGHHQI
ERISLGEEHGHLEHAEPHYETHESHGHDEHVDYYAPPKYAFKYGVNDFHT
GDVKSQHETRDGDTVKGQYSLVEPDGSIRTVDYTADKHNGFNAVVHKTAP
VHHHEELHEHHY*

IP05056.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10288-PA 157 GF10288-PA 1..157 1..162 675 92 Plus
Dana\GF24956-PA 188 GF24956-PA 13..118 50..150 308 62.3 Plus
Dana\GF10287-PA 375 GF10287-PA 34..108 76..150 293 74.7 Plus
Dana\GF24957-PA 189 GF24957-PA 27..103 81..157 286 74 Plus
Dana\GF23679-PA 196 GF23679-PA 8..144 6..149 249 49.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14302-PA 162 GG14302-PA 1..162 1..162 820 99.4 Plus
Dere\GG14555-PA 180 GG14555-PA 13..115 50..150 312 64.8 Plus
Dere\GG14556-PA 228 GG14556-PA 27..103 81..157 287 74 Plus
Dere\GG16040-PA 424 GG16040-PA 47..112 84..145 241 71.2 Plus
Dere\GG16039-PA 198 GG16039-PA 8..156 6..159 235 44.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15054-PA 167 GH15054-PA 1..150 1..151 645 86.3 Plus
Dgri\GH15041-PA 182 GH15041-PA 41..117 75..150 305 79.2 Plus
Dgri\GH15042-PA 191 GH15042-PA 27..103 81..157 293 76.6 Plus
Dgri\GH15052-PA 136 GH15052-PA 40..113 77..150 278 73 Plus
Dgri\GH17179-PA 391 GH17179-PA 18..76 87..145 240 74.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr66Cb-PA 162 CG7076-PA 1..162 1..162 921 100 Plus
Cpr62Bc-PB 180 CG1919-PB 17..119 54..154 349 66.3 Plus
Cpr62Bc-PA 180 CG1919-PA 17..119 54..154 349 66.3 Plus
CG34461-PB 138 CG34461-PB 20..138 58..162 322 58 Plus
CG34461-PA 138 CG34461-PA 20..138 58..162 322 58 Plus
Cpr62Bb-PC 194 CG13935-PC 27..99 81..153 298 78.1 Plus
Cpr62Bb-PB 194 CG13935-PB 27..99 81..153 298 78.1 Plus
Cpr62Bb-PA 194 CG13935-PA 27..99 81..153 298 78.1 Plus
Cpr35B-PA 218 CG3474-PA 23..144 29..161 290 45.9 Plus
Cpr76Bb-PA 198 CG9290-PA 11..156 11..159 279 43.4 Plus
Cpr76Ba-PA 204 CG9283-PA 1..171 1..162 257 38.3 Plus
Cpr92A-PA 245 CG6240-PA 31..136 39..152 252 47.1 Plus
Cpr76Bc-PD 424 CG9295-PD 46..120 79..154 243 63.2 Plus
Cpr76Bc-PC 424 CG9295-PC 46..120 79..154 243 63.2 Plus
Ccp84Ac-PA 217 CG1327-PA 1..133 1..157 229 39.5 Plus
Cpr30F-PA 146 CG31876-PA 37..103 81..147 227 62.7 Plus
Cpr76Bd-PD 1228 CG9299-PD 1143..1209 77..145 222 65.2 Plus
Cpr76Bd-PB 1228 CG9299-PB 1143..1209 77..145 222 65.2 Plus
Cpr76Bd-PC 1231 CG9299-PC 1146..1212 77..145 222 65.2 Plus
Cpr64Ad-PB 247 CG1259-PB 142..208 85..151 217 64.2 Plus
Crys-PB 477 CG16963-PB 70..135 82..147 211 62.1 Plus
Crys-PA 477 CG16963-PA 70..135 82..147 211 62.1 Plus
Cpr64Ab-PA 120 CG15007-PA 40..100 87..147 210 67.2 Plus
Cpr64Ac-PA 188 CG15008-PA 86..150 83..147 207 63.1 Plus
Cpr23B-PA 302 CG2973-PA 104..215 39..147 207 41.6 Plus
Cpr64Aa-PA 192 CG15006-PA 54..122 83..151 202 58 Plus
Edg84A-PA 188 CG2345-PA 31..95 83..147 201 61.5 Plus
Ccp84Ab-PA 221 CG1252-PA 55..120 82..147 200 59.1 Plus
Cpr31A-PA 340 CG33302-PA 125..193 79..147 198 56.5 Plus
Ccp84Aa-PA 205 CG2360-PA 55..120 82..147 194 57.6 Plus
Cpr5C-PA 145 CG4052-PA 57..122 82..147 191 57.6 Plus
Ccp84Ad-PA 199 CG2341-PA 55..120 82..147 190 56.1 Plus
CG13670-PA 266 CG13670-PA 95..159 81..145 189 55.4 Plus
Ccp84Af-PA 151 CG1331-PA 44..125 64..153 186 47.8 Plus
Cpr30B-PA 153 CG3818-PA 28..91 84..147 186 53.1 Plus
Ccp84Ag-PA 191 CG2342-PA 33..100 81..147 185 57.4 Plus
CG42367-PC 103 CG42367-PC 35..97 85..147 182 57.1 Plus
Ccp84Ae-PA 208 CG1330-PA 43..109 79..147 179 53.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12820-PA 164 GI12820-PA 1..164 1..162 666 83.8 Plus
Dmoj\GI12933-PA 163 GI12933-PA 13..125 50..160 324 62.8 Plus
Dmoj\GI11675-PA 176 GI11675-PA 43..116 77..150 306 78.4 Plus
Dmoj\GI12819-PA 389 GI12819-PA 55..129 76..150 298 74.7 Plus
Dmoj\GI11676-PA 187 GI11676-PA 27..103 81..157 292 75.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24694-PA 159 GL24694-PA 1..159 1..162 691 93.9 Plus
Dper\GL24822-PA 183 GL24822-PA 13..119 50..155 315 64.2 Plus
Dper\GL24692-PA 133 GL24692-PA 36..120 76..158 295 69.4 Plus
Dper\GL24824-PA 195 GL24824-PA 27..103 81..157 290 75.3 Plus
Dper\GL20937-PA 198 GL20937-PA 65..150 59..153 241 57.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:12:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20083-PA 159 GA20083-PA 1..159 1..162 691 93.9 Plus
Dpse\GA15131-PA 183 GA15131-PA 13..119 50..155 316 64.2 Plus
Dpse\GA23954-PA 133 GA23954-PA 36..120 76..158 295 69.4 Plus
Dpse\GA12639-PA 195 GA12639-PA 27..103 81..157 290 75.3 Plus
Dpse\GA21674-PA 198 GA21674-PA 65..150 59..153 241 57.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25044-PA 162 GM25044-PA 1..162 1..162 828 100 Plus
Dsec\GM14163-PA 180 GM14163-PA 13..116 50..151 311 64.2 Plus
Dsec\GM14164-PA 225 GM14164-PA 27..103 81..157 288 74 Plus
Dsec\GM19580-PA 198 GM19580-PA 84..156 87..159 234 65.8 Plus
Dsec\GM26903-PA 245 GM26903-PA 66..126 87..147 231 70.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14081-PA 162 GD14081-PA 1..162 1..162 823 99.4 Plus
Dsim\GD13434-PA 180 GD13434-PA 13..116 50..151 311 64.2 Plus
Dsim\GD17606-PA 192 GD17606-PA 27..103 81..157 291 74 Plus
Dsim\GD14078-PA 177 GD14078-PA 59..152 58..150 289 64.9 Plus
Dsim\GD14807-PA 198 GD14807-PA 84..156 87..159 234 65.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12963-PA 164 GJ12963-PA 1..150 1..151 656 88.9 Plus
Dvir\GJ12945-PA 178 GJ12945-PA 35..115 71..150 304 74.1 Plus
Dvir\GJ12946-PA 185 GJ12946-PA 27..103 81..157 294 76.6 Plus
Dvir\GJ12961-PA 135 GJ12961-PA 38..112 76..150 293 74.7 Plus
Dvir\GJ13494-PA 198 GJ13494-PA 5..148 3..153 239 45.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11921-PA 158 GK11921-PA 1..158 1..162 593 84.2 Plus
Dwil\GK20563-PA 184 GK20563-PA 41..114 77..150 305 78.4 Plus
Dwil\GK20564-PA 195 GK20564-PA 27..103 81..157 297 76.6 Plus
Dwil\GK11910-PA 389 GK11910-PA 39..112 77..150 297 75.7 Plus
Dwil\GK20220-PA 431 GK20220-PA 45..110 84..145 242 71.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20730-PA 162 GE20730-PA 1..162 1..162 828 100 Plus
Dyak\GE20909-PA 180 GE20909-PA 13..116 50..151 311 64.2 Plus
Dyak\GE20910-PA 229 GE20910-PA 27..103 81..157 287 74 Plus
Dyak\GE19605-PA 195 GE19605-PA 8..153 6..159 245 45.2 Plus
Dyak\GE23205-PA 198 GE23205-PA 8..156 6..159 239 45.2 Plus