Clone IP05061 Report

Search the DGRC for IP05061

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:50
Well:61
Vector:pOT2
Associated Gene/TranscriptCG7949-RA
Protein status:IP05061.pep: gold
Preliminary Size:471
Sequenced Size:657

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7949 2005-01-01 Successful iPCR screen
CG7949 2008-04-29 Release 5.5 accounting
CG7949 2008-08-15 Release 5.9 accounting
CG7949 2008-12-18 5.12 accounting

Clone Sequence Records

IP05061.complete Sequence

657 bp (657 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024397

> IP05061.complete
GCTTATTGTTTCTCTTTGCTCTTCGCCAAAAAAACGTGTAAATGAAGGGT
TTTCAAGAAAAGAACAATACAAAATGCCCACGGAAATCGAGAACATCAAC
CCCAATGTCTACGACAGAATCAAGGAAAGGGTATTAACCGCCAACGAAGA
AGACGAAAACGTGCCCGATCCATTTGACAAACGAGAGATTTTCGATCTCA
TCAGAAATATTAATGACCCGGAACATCCTTTGACCCTGGAGGAGCTGCAT
GTGGTGCAGGAAGATCTAATCCGGATAAACGATAGCCAGAATTCCGTGCA
CATCAGCTTCACCCCGACGATTCCCCATTGCTCGATGGCCACTTTGATTG
GCCTCTCCATCCGGGTGAAGTTGCTCCGCTCGCTGCCACCTCGCTTTAAG
GTCACCGTGGAAATAACGCCCGGCACCCACGCCTCCGAGCTGGCGGTGAA
CAAGCAGCTGGCAGACAAGGAACGAGTGGCCGCCGCCCTGGAGAACAATC
ACCTCGCCGAGGTGATCAACCAGTGCATCGCCGCCAAGGGTTAACTACAT
GATTTTATCCTCGTTTTAGATATATATAAATATATATATAATGATGTTGG
TTTAGTAATAATAATTTTGTTTTAAAAGCAAAAAAAAAAAAAAAAAAAAA
AAAAAAA

IP05061.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7949-RA 679 CG7949-RA 30..659 1..630 3135 99.8 Plus
CG7949.a 651 CG7949.a 68..651 46..629 2920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10874215..10874649 194..628 2160 99.8 Plus
chr3L 24539361 chr3L 10873967..10874160 1..194 880 96.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10883138..10883574 194..630 2185 100 Plus
3L 28110227 3L 10882890..10883083 1..194 955 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10876238..10876674 194..630 2185 100 Plus
3L 28103327 3L 10875990..10876183 1..194 955 99.4 Plus
Blast to na_te.dros performed 2019-03-16 13:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 4603..4652 53..4 106 68 Minus

IP05061.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:11:31 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10873967..10874160 1..194 96 -> Plus
chr3L 10874216..10874649 195..629 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:55 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:45 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:49:40 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:08:01 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:10:20 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:13 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:45 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:49:40 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..629 1..629 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:08:01 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..471 74..544 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:10:20 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
CG7949-RA 1..629 1..629 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:11:31 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10882890..10883083 1..194 99 -> Plus
3L 10883139..10883573 195..629 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:11:31 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10882890..10883083 1..194 99 -> Plus
3L 10883139..10883573 195..629 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:11:31 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10882890..10883083 1..194 99 -> Plus
3L 10883139..10883573 195..629 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:49:40 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10875990..10876183 1..194 99 -> Plus
arm_3L 10876239..10876673 195..629 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:08 Download gff for IP05061.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10875990..10876183 1..194 99 -> Plus
3L 10876239..10876673 195..629 100   Plus

IP05061.hyp Sequence

Translation from 0 to 543

> IP05061.hyp
LIVSLCSSPKKRVNKGFSRKEQYKMPTEIENINPNVYDRIKERVLTANEE
DENVPDPFDKREIFDLIRNINDPEHPLTLEELHVVQEDLIRINDSQNSVH
ISFTPTIPHCSMATLIGLSIRVKLLRSLPPRFKVTVEITPGTHASELAVN
KQLADKERVAAALENNHLAEVINQCIAAKG*

IP05061.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG7949-PA 156 CG7949-PA 1..156 25..180 799 100 Plus
CG30152-PD 152 CG30152-PD 31..148 63..176 301 51.7 Plus
CG30152-PC 218 CG30152-PC 97..214 63..176 301 51.7 Plus
CG30152-PB 218 CG30152-PB 97..214 63..176 301 51.7 Plus
CG30152-PA 218 CG30152-PA 97..214 63..176 301 51.7 Plus

IP05061.pep Sequence

Translation from 73 to 543

> IP05061.pep
MPTEIENINPNVYDRIKERVLTANEEDENVPDPFDKREIFDLIRNINDPE
HPLTLEELHVVQEDLIRINDSQNSVHISFTPTIPHCSMATLIGLSIRVKL
LRSLPPRFKVTVEITPGTHASELAVNKQLADKERVAAALENNHLAEVINQ
CIAAKG*

IP05061.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:12:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10614-PA 156 GF10614-PA 1..156 1..156 746 91 Plus
Dana\GF12194-PA 207 GF12194-PA 86..203 39..152 296 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15455-PA 156 GG15455-PA 1..156 1..156 787 97.4 Plus
Dere\GG22053-PA 222 GG22053-PA 101..218 39..152 301 51.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23231-PA 156 GH23231-PA 1..156 1..156 723 87.2 Plus
Dgri\GH14512-PA 156 GH14512-PA 1..156 1..156 723 87.2 Plus
Dgri\GH21994-PA 189 GH21994-PA 68..185 39..152 302 50.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
galla-2-PA 156 CG7949-PA 1..156 1..156 799 100 Plus
galla-1-PD 152 CG30152-PD 31..148 39..152 301 51.7 Plus
galla-1-PC 218 CG30152-PC 97..214 39..152 301 51.7 Plus
galla-1-PB 218 CG30152-PB 97..214 39..152 301 51.7 Plus
galla-1-PA 218 CG30152-PA 97..214 39..152 301 51.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13290-PA 156 GI13290-PA 1..156 1..156 734 89.1 Plus
Dmoj\GI19694-PA 187 GI19694-PA 66..183 39..152 303 51.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21874-PA 156 GL21874-PA 1..156 1..156 738 91 Plus
Dper\GL17044-PA 211 GL17044-PA 90..207 39..152 303 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20712-PA 156 GA20712-PA 1..156 1..156 732 90.4 Plus
Dpse\GA15681-PA 211 GA15681-PA 90..207 39..152 303 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25231-PA 156 GM25231-PA 1..156 1..156 793 98.1 Plus
Dsec\GM22037-PA 218 GM22037-PA 97..214 39..152 302 51.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14263-PA 156 GD14263-PA 1..156 1..156 798 98.7 Plus
Dsim\GD11534-PA 218 GD11534-PA 97..214 39..152 301 51.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12056-PA 156 GJ12056-PA 1..156 1..156 744 89.7 Plus
Dvir\GJ17321-PA 190 GJ17321-PA 69..186 39..152 304 51.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17777-PA 156 GK17777-PA 1..156 1..156 745 91.7 Plus
Dwil\GK21825-PA 191 GK21825-PA 70..187 39..152 298 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21767-PA 156 GE21767-PA 1..156 1..156 773 94.9 Plus
Dyak\GE12134-PA 224 GE12134-PA 103..220 39..152 296 50.8 Plus