Clone IP05064 Report

Search the DGRC for IP05064

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:50
Well:64
Vector:pOT2
Associated Gene/TranscriptVha16-4-RA
Protein status:IP05064.pep: gold
Preliminary Size:468
Sequenced Size:582

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9013 2008-08-15 Release 5.9 accounting
CG9013 2008-12-18 5.12 accounting

Clone Sequence Records

IP05064.complete Sequence

582 bp assembled on 2008-06-09

GenBank Submission: BT033048

> IP05064.complete
CAAACCTGGAATTGTTCCTTTAAGAAGTACGACGTAAGACTAAAATATGG
AGCTCTCGTTGGATGAACCGCAATGCGCATCCTTCTTTTGCATCCTGGGT
GCCGTGTGCGCCATTGTCTTTTCGACATTGGGAGCCGCCTACGGAACAGC
GAAGGCTTCTGTGGGAATCTCTTCGATGTCAATCAAGCATCCGCAGCTGA
TCATGAAGGCGATTGTTCCAGTGGTTATGGCTGGCATTATAGCCATTTAT
GGACTGGTGATCGCGGTCCTGCTTGCTGGATCACTTAGCAGCCCCTATAG
CGCCTACAAGGGTTTCCTAAACCTCAGTGCTGGACTGGCGGTGGGAGTCT
CTGGGATGGGGGCTGGAATTGCTATTGGCGTGGTGGGCGAAGCTGGAGTC
CGTGCATCTGCCCAGCAGCCAAAACTCTTTGTGGCCATCATTTTAATATT
GATATTTGCCGAGGTCTTGGGTCTGTATGGTCTCATAGTGGCCATTTATT
TGTTTTCCAAGTAGTGGGAGTTATGCCTACCTTTGCTGTTATTAAAGAAA
AACTGGTTTGATACATTAAAAAAAAAAAAAAA

IP05064.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15614.b 3031 CG15614.b 2134..2700 567..1 2835 100 Minus
CG15614.a 2848 CG15614.a 1951..2517 567..1 2835 100 Minus
CG15614-RA 2833 CG15614-RA 1936..2502 567..1 2835 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12834852..12835418 567..1 2790 99.5 Minus
chr3L 24539361 chr3L 11464545..11464686 357..498 200 76.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16947658..16948224 567..1 2835 100 Minus
3L 28110227 3L 11473727..11473868 357..498 215 76.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16948857..16949423 567..1 2835 100 Minus
3L 28103327 3L 11466827..11466968 357..498 215 76.7 Plus
Blast to na_custom.ecoli performed on 2008-06-09 15:39:11 has no hits.
Blast to na_te.dros performed 2019-03-16 21:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2161..2253 469..380 106 60.2 Minus

IP05064.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:27:28 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12834852..12835418 1..567 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:56 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
CG9013-RA 1..468 47..514 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:07:38 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-4-RA 1..468 47..514 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:05 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-4-RA 1..468 47..514 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:17:44 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
CG9013-RA 1..468 47..514 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:19:46 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-4-RA 1..468 47..514 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:36:36 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
CG15614-RA 1907..2473 1..567 100   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:07:37 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
CG15614-RA 1951..2517 1..567 100   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:05 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-4-RA 1..567 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:17:44 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
CG15614-RA 1907..2473 1..567 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:19:46 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-4-RA 1..567 1..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:28 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16947658..16948224 1..567 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:28 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16947658..16948224 1..567 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:27:28 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16947658..16948224 1..567 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:05 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12835163..12835729 1..567 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:40:45 Download gff for IP05064.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16948857..16949423 1..567 100   Minus

IP05064.pep Sequence

Translation from 46 to 513

> IP05064.pep
MELSLDEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQ
LIMKAIVPVVMAGIIAIYGLVIAVLLAGSLSSPYSAYKGFLNLSAGLAVG
VSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILILIFAEVLGLYGLIVAI
YLFSK*

IP05064.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13808-PA 159 GF13808-PA 4..159 2..155 520 66.7 Plus
Dana\GF25265-PA 157 GF25265-PA 8..157 6..155 511 66 Plus
Dana\GF13441-PA 202 GF13441-PA 13..140 4..131 506 78.1 Plus
Dana\GF19671-PA 180 GF19671-PA 27..176 7..154 425 56.7 Plus
Dana\GF25266-PA 159 GF25266-PA 4..157 2..155 399 61.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22236-PA 158 GG22236-PA 5..158 2..155 695 94.8 Plus
Dere\GG10820-PA 159 GG10820-PA 4..159 2..155 526 67.9 Plus
Dere\GG15504-PA 158 GG15504-PA 9..158 6..155 502 65.3 Plus
Dere\GG15505-PA 158 GG15505-PA 8..157 6..155 476 61.3 Plus
Dere\GG10362-PA 191 GG10362-PA 34..187 4..154 398 54.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22892-PA 161 GH22892-PA 6..161 2..155 520 66.7 Plus
Dgri\GH16652-PA 161 GH16652-PA 8..161 2..155 504 64.9 Plus
Dgri\GH12724-PA 161 GH12724-PA 8..161 2..155 504 64.9 Plus
Dgri\GH16653-PA 159 GH16653-PA 5..158 2..155 483 64.3 Plus
Dgri\GH10920-PA 173 GH10920-PA 22..171 8..155 447 60 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-4-PA 155 CG9013-PA 1..155 1..155 748 100 Plus
Vha16-1-PB 159 CG3161-PB 4..159 2..155 536 67.9 Plus
Vha16-1-PA 159 CG3161-PA 4..159 2..155 536 67.9 Plus
Vha16-1-PD 159 CG3161-PD 4..159 2..155 536 67.9 Plus
Vha16-1-PC 159 CG3161-PC 4..159 2..155 536 67.9 Plus
Vha16-3-PB 158 CG32090-PB 9..158 6..155 515 66 Plus
Vha16-3-PA 158 CG32090-PA 9..158 6..155 515 66 Plus
Vha16-2-PA 158 CG32089-PA 8..157 6..155 473 60 Plus
Vha16-5-PA 193 CG6737-PA 41..189 8..154 417 55 Plus
VhaPPA1-2-PB 212 CG7026-PB 56..207 17..155 243 34.9 Plus
VhaPPA1-1-PB 212 CG7007-PB 54..205 17..155 231 34.2 Plus
VhaPPA1-1-PA 212 CG7007-PA 54..205 17..155 231 34.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21278-PA 159 GI21278-PA 6..159 4..155 523 68.2 Plus
Dmoj\GI11612-PA 158 GI11612-PA 9..158 6..155 502 66 Plus
Dmoj\GI11613-PA 158 GI11613-PA 4..157 2..155 450 62.3 Plus
Dmoj\GI13313-PA 175 GI13313-PA 24..173 8..155 426 58.7 Plus
Dmoj\GI22994-PA 212 GI22994-PA 54..205 17..155 185 34.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10499-PA 165 GL10499-PA 12..165 2..155 602 77.9 Plus
Dper\GL10498-PA 165 GL10498-PA 12..165 2..155 601 77.9 Plus
Dper\GL20293-PA 159 GL20293-PA 4..159 2..155 517 65.4 Plus
Dper\GL21511-PA 162 GL21511-PA 13..162 6..155 511 68 Plus
Dper\GL26032-PA 182 GL26032-PA 31..179 8..154 433 59.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21477-PA 165 GA21477-PA 12..165 2..155 606 78.6 Plus
Dpse\GA16335-PA 159 GA16335-PA 4..159 2..155 517 65.4 Plus
Dpse\GA26304-PA 162 GA26304-PA 13..162 6..155 510 68 Plus
Dpse\GA25245-PA 182 GA25245-PA 31..179 8..154 433 59.7 Plus
Dpse\GA26306-PA 159 GA26306-PA 6..158 3..155 389 59.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20023-PA 158 GM20023-PA 5..158 2..155 731 99.4 Plus
Dsec\GM20869-PA 159 GM20869-PA 4..159 2..155 526 67.9 Plus
Dsec\GM25273-PA 158 GM25273-PA 9..158 6..155 507 66 Plus
Dsec\GM25274-PA 158 GM25274-PA 8..157 6..155 463 60 Plus
Dsec\GM11483-PA 191 GM11483-PA 35..187 5..154 398 54.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25509-PA 158 GD25509-PA 5..158 2..155 731 99.4 Plus
Dsim\GD10321-PA 159 GD10321-PA 4..159 2..155 526 67.9 Plus
Dsim\GD14307-PA 158 GD14307-PA 9..158 6..155 507 66 Plus
Dsim\GD14308-PA 165 GD14308-PA 8..164 6..155 429 56.1 Plus
Dsim\GD22230-PA 191 GD22230-PA 35..187 5..154 398 54.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20880-PA 158 GJ20880-PA 5..158 4..155 514 67.5 Plus
Dvir\GJ11291-PA 159 GJ11291-PA 6..159 2..155 502 64.9 Plus
Dvir\GJ11292-PA 159 GJ11292-PA 9..158 6..155 467 62.7 Plus
Dvir\GJ11943-PA 179 GJ11943-PA 28..177 8..155 448 58.7 Plus
Dvir\GJ24692-PA 212 GJ24692-PA 54..205 17..155 185 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22034-PA 160 GK22034-PA 7..160 2..155 585 74.7 Plus
Dwil\GK19648-PA 159 GK19648-PA 4..159 2..155 526 67.9 Plus
Dwil\GK17170-PA 160 GK17170-PA 11..160 6..155 508 67.3 Plus
Dwil\GK17171-PA 160 GK17171-PA 10..159 6..155 486 64.7 Plus
Dwil\GK18316-PA 184 GK18316-PA 32..180 8..154 435 59.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14233-PA 158 GE14233-PA 5..158 2..155 696 94.2 Plus
Dyak\Vha16-PA 159 GE24687-PA 4..159 2..155 526 67.9 Plus
Dyak\GE21812-PA 158 GE21812-PA 9..158 6..155 506 66 Plus
Dyak\GE21813-PA 158 GE21813-PA 8..157 6..155 455 58 Plus
Dyak\GE13384-PA 191 GE13384-PA 34..187 4..154 357 55.2 Plus

IP05064.hyp Sequence

Translation from 46 to 513

> IP05064.hyp
MELSLDEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQ
LIMKAIVPVVMAGIIAIYGLVIAVLLAGSLSSPYSAYKGFLNLSAGLAVG
VSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILILIFAEVLGLYGLIVAI
YLFSK*

IP05064.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:32:44
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-4-PA 155 CG9013-PA 1..155 1..155 748 100 Plus
Vha16-1-PB 159 CG3161-PB 4..159 2..155 536 67.9 Plus
Vha16-1-PA 159 CG3161-PA 4..159 2..155 536 67.9 Plus
Vha16-1-PD 159 CG3161-PD 4..159 2..155 536 67.9 Plus
Vha16-1-PC 159 CG3161-PC 4..159 2..155 536 67.9 Plus