Clone IP05203 Report

Search the DGRC for IP05203

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:52
Well:3
Vector:pOT2
Associated Gene/TranscriptCG10822-RA
Protein status:IP05203.pep: gold
Preliminary Size:345
Sequenced Size:485

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10822 2005-01-01 Successful iPCR screen
CG10822 2008-04-29 Release 5.5 accounting
CG10822 2008-08-15 Release 5.9 accounting
CG10822 2008-12-18 5.12 accounting

Clone Sequence Records

IP05203.complete Sequence

485 bp assembled on 2006-11-09

GenBank Submission: BT023654

> IP05203.complete
TTTAAAAAAAACTGTAGGCAAAATGCAGGAAGCAGAGACAGATCCAAAGC
GAACTAAAAGTTACGTGGAAGAAGTATTTCGCAAAGTGCAGGAGAAACCC
GGCGTGGAGGACATATTGATCATGAATCACTCGGGTGTGCCGGTGAAAAC
CTCGATGGATCGTCAGGAGGGCTTGCAGTACGCCTGTCTATATGACAATT
TGCGGGAGAAGTGCCAGGCGTTCCTCTCCAAAATGGAGCCAGCCCAAAAT
TTGACTCTACTGAGAGTTCGTACCAAGTATCACGAGGTGCTCATTACACC
AGATGCCAAGATCACCGTTTTGGTGGTTCAGAATGCCAAAGATACTTTTC
TTAACATAAAGGGTTAGCATTTAGCACATATTATGCTGTTTATAATTGCC
ACACAAGTATTAAATAAAGTTTTCAGTTGGACGATTGCTATTACCAACTG
AAAGCCTTTGAAGAGCAAAAAAAAAAAAAAAAAAA

IP05203.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG10822-RA 574 CG10822-RA 90..560 1..471 2340 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15838691..15839107 44..466 1960 98.1 Plus
chr2R 21145070 chr2R 15838596..15838638 1..43 215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19951528..19951955 44..471 2125 99.8 Plus
2R 25286936 2R 19951433..19951475 1..43 215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19952727..19953154 44..471 2125 99.7 Plus
2R 25260384 2R 19952632..19952674 1..43 215 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:54:41 has no hits.

IP05203.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:55:44 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15838596..15838638 1..43 100 -> Plus
chr2R 15838691..15839107 44..466 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:15 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..345 23..367 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:47 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..345 23..367 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:20:37 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..345 23..367 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:18 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..345 23..367 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:47 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..345 23..367 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:08 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..466 1..466 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:47 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..466 1..466 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:20:37 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 89..554 1..466 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:19 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 1..345 23..367 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:47 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
CG10822-RA 89..554 1..466 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:44 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19951433..19951475 1..43 100 -> Plus
2R 19951528..19951950 44..466 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:44 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19951433..19951475 1..43 100 -> Plus
2R 19951528..19951950 44..466 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:55:44 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19951433..19951475 1..43 100 -> Plus
2R 19951528..19951950 44..466 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:20:37 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15838938..15838980 1..43 100 -> Plus
arm_2R 15839033..15839455 44..466 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:03 Download gff for IP05203.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19952632..19952674 1..43 100 -> Plus
2R 19952727..19953149 44..466 100   Plus

IP05203.hyp Sequence

Translation from 0 to 366

> IP05203.hyp
LKKTVGKMQEAETDPKRTKSYVEEVFRKVQEKPGVEDILIMNHSGVPVKT
SMDRQEGLQYACLYDNLREKCQAFLSKMEPAQNLTLLRVRTKYHEVLITP
DAKITVLVVQNAKDTFLNIKG*

IP05203.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:33:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG10822-PA 114 CG10822-PA 1..114 8..121 583 100 Plus
robls54B-PA 112 CG34192-PA 9..110 15..116 242 45.1 Plus
robls54B-PB 112 CG34192-PB 9..110 15..116 242 45.1 Plus
robl-PA 97 CG10751-PA 5..97 22..114 199 35.5 Plus
CG10834-PA 97 CG10834-PA 5..94 22..111 159 31.1 Plus

IP05203.pep Sequence

Translation from 22 to 366

> IP05203.pep
MQEAETDPKRTKSYVEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEG
LQYACLYDNLREKCQAFLSKMEPAQNLTLLRVRTKYHEVLITPDAKITVL
VVQNAKDTFLNIKG*

IP05203.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12509-PA 141 GF12509-PA 29..134 8..113 503 87.7 Plus
Dana\GF13122-PA 97 GF13122-PA 5..97 15..107 207 35.5 Plus
Dana\GF19782-PA 68 GF19782-PA 1..68 45..112 173 45.6 Plus
Dana\GF21526-PA 97 GF21526-PA 5..93 15..103 162 33.7 Plus
Dana\GF15283-PA 97 GF15283-PA 5..93 15..103 161 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22008-PA 114 GG22008-PA 1..114 1..114 590 96.5 Plus
Dere\GG22195-PA 104 GG22195-PA 1..102 8..109 242 44.1 Plus
Dere\GG20680-PA 100 GG20680-PA 8..100 15..107 207 35.5 Plus
Dere\GG21468-PA 97 GG21468-PA 5..94 15..104 164 32.2 Plus
Dere\GG24530-PA 97 GG24530-PA 5..97 15..107 158 31.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22877-PA 116 GH22877-PA 1..110 1..110 438 72.7 Plus
Dgri\GH20486-PA 108 GH20486-PA 9..106 8..105 257 48 Plus
Dgri\GH21399-PA 97 GH21399-PA 5..97 15..107 207 35.5 Plus
Dgri\GH13788-PA 97 GH13788-PA 5..97 15..107 149 29 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG10822-PA 114 CG10822-PA 1..114 1..114 583 100 Plus
robls54B-PA 112 CG34192-PA 9..110 8..109 242 45.1 Plus
robls54B-PB 112 CG34192-PB 9..110 8..109 242 45.1 Plus
robl-PA 97 CG10751-PA 5..97 15..107 199 35.5 Plus
CG10834-PA 97 CG10834-PA 5..94 15..104 159 31.1 Plus
robl22E-PB 97 CG10838-PB 5..97 15..107 158 31.2 Plus
robl22E-PA 97 CG10838-PA 5..97 15..107 158 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21258-PA 115 GI21258-PA 1..110 1..110 449 74.5 Plus
Dmoj\GI21029-PA 100 GI21029-PA 1..98 8..105 230 40.8 Plus
Dmoj\GI18578-PA 108 GI18578-PA 16..108 15..107 207 35.5 Plus
Dmoj\GI16945-PA 110 GI16945-PA 4..85 15..96 165 32.9 Plus
Dmoj\GI17191-PA 97 GI17191-PA 5..97 15..107 136 26.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11036-PA 89 GL11036-PA 1..80 34..113 338 76.2 Plus
Dper\GL11426-PA 97 GL11426-PA 5..97 15..107 207 35.5 Plus
Dper\GL10663-PA 67 GL10663-PA 1..65 45..109 162 46.2 Plus
Dper\GL26110-PA 97 GL26110-PA 5..93 15..103 161 33.7 Plus
Dper\GL19405-PA 97 GL19405-PA 5..93 15..103 156 32.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24584-PA 89 GA24584-PA 1..80 34..113 338 76.2 Plus
Dpse\GA10543-PA 97 GA10543-PA 5..97 15..107 207 35.5 Plus
Dpse\GA10585-PA 97 GA10585-PA 5..93 15..103 162 33.7 Plus
Dpse\GA24438-PA 67 GA24438-PA 1..65 45..109 158 46.2 Plus
Dpse\GA10586-PA 97 GA10586-PA 5..93 15..103 156 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:21:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21987-PA 114 GM21987-PA 1..114 1..114 587 96.5 Plus
Dsec\GM19981-PA 112 GM19981-PA 9..110 8..109 244 44.1 Plus
Dsec\GM26652-PA 112 GM26652-PA 9..108 8..107 238 44 Plus
Dsec\GM21776-PA 97 GM21776-PA 5..97 15..107 207 35.5 Plus
Dsec\GM26651-PA 97 GM26651-PA 5..97 15..107 207 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11487-PA 111 GD11487-PA 1..110 1..110 571 97.3 Plus
Dsim\GD11269-PA 97 GD11269-PA 5..97 15..107 207 35.5 Plus
Dsim\GD21619-PA 97 GD21619-PA 5..94 15..104 165 32.2 Plus
Dsim\GD22844-PA 97 GD22844-PA 5..97 15..107 154 31.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20860-PA 116 GJ20860-PA 1..111 1..111 438 72.1 Plus
Dvir\GJ21956-PA 106 GJ21956-PA 7..104 8..105 255 45.9 Plus
Dvir\GJ20372-PA 97 GJ20372-PA 5..97 15..107 207 35.5 Plus
Dvir\GJ22281-PA 97 GJ22281-PA 5..97 15..107 142 26.9 Plus
Dvir\GJ21607-PA 119 GJ21607-PA 13..115 4..106 132 26.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15784-PA 118 GK15784-PA 5..112 4..111 400 66.7 Plus
Dwil\GK19223-PA 113 GK19223-PA 1..102 8..109 267 47.1 Plus
Dwil\GK22899-PA 97 GK22899-PA 5..97 15..107 207 35.5 Plus
Dwil\GK18698-PA 97 GK18698-PA 5..97 15..107 171 34.4 Plus
Dwil\GK19376-PA 116 GK19376-PA 3..94 13..104 153 29.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12086-PA 114 GE12086-PA 1..114 1..114 580 94.7 Plus
Dyak\GE14190-PA 104 GE14190-PA 3..102 10..109 240 42 Plus
Dyak\GE11664-PA 97 GE11664-PA 5..97 15..107 207 35.5 Plus
Dyak\GE12939-PA 97 GE12939-PA 5..94 15..104 167 33.3 Plus
Dyak\GE15136-PA 97 GE15136-PA 5..97 15..107 156 33.3 Plus