Clone IP05205 Report

Search the DGRC for IP05205

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:52
Well:5
Vector:pOT2
Associated Gene/TranscriptAtg12-RB
Protein status:IP05205.pep: gold
Preliminary Size:357
Sequenced Size:494

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10861 2005-01-01 Successful iPCR screen
Atg12 2008-04-29 Release 5.5 accounting
Atg12 2008-08-15 Release 5.9 accounting
Atg12 2008-12-18 5.12 accounting

Clone Sequence Records

IP05205.complete Sequence

494 bp (494 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022374

> IP05205.complete
TTTTAATTCATTAATTAGGAACTATTTAATTTAGTTACATTCCAAATAAA
TGGCAGAGACACCAGAATCCCAGGCAGCGCTGAGCACTTCCTCCTCCACA
CCTGCAGATAAGGATGGTTCCAAAATTTGTATCCTTCTGAACGCCACTGG
CAATGTGCCCATCATCAAAAAGCGAACCTGGACCGTAGATCCCAACAAGA
CAGTCGGCTGGATACAGACGTTCATCCACAAGTTTCTGAAACTCGATGCC
AGCGAGCAAATTTTCCTGTACGTTAATCAGACATTTGCACCTGCCCCGGA
TCAGATAATCAAGAACTTGTACGAGTGCCATGGAACCAATGGGAAACTGG
TGCTCTACTACTGCAAGAATCAGGCGTGGGGCTAAATCGATACGCACATG
ACTTTGCTAAGTCTTAAGTATTTATTCGACTACTGTGTAATTTTTATATT
ATTAAATGTGAATAAGATGAAAAAAAAAAAAAAAAAAAAAAAAA

IP05205.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:48
Subject Length Description Subject Range Query Range Score Percent Strand
Atg12-RB 674 Atg12-RB 194..663 1..470 2350 100 Plus
l(3)neo18-RA 965 l(3)neo18-RA 876..965 470..381 450 100 Minus
l(3)neo18.a 910 l(3)neo18.a 843..910 470..403 340 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12128102..12128308 263..469 1035 100 Plus
chr3L 24539361 chr3L 12127908..12128044 126..262 685 100 Plus
chr3L 24539361 chr3L 12127716..12127840 1..125 625 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:44:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12137353..12137560 263..470 1040 100 Plus
3L 28110227 3L 12137159..12137295 126..262 685 100 Plus
3L 28110227 3L 12136967..12137091 1..125 625 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12130453..12130660 263..470 1040 100 Plus
3L 28103327 3L 12130259..12130395 126..262 685 100 Plus
3L 28103327 3L 12130067..12130191 1..125 625 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:43:52 has no hits.

IP05205.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:44:51 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12127716..12127840 1..125 100 -> Plus
chr3L 12127908..12128044 126..262 100 -> Plus
chr3L 12128102..12128308 263..469 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:16 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 1..336 50..385 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:58 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 1..336 50..385 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:58 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 1..336 50..385 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:53:29 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RA 217..321 281..385 100   Plus
Atg12-RA 1..12 114..125 100 -> Plus
Atg12-RA 80..216 126..262 100 == Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:24 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 1..336 50..385 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:00:14 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 194..662 1..469 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:58 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 194..662 1..469 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:58 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 1..469 1..469 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:53:29 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RA 1..12 114..125 100 -> Plus
Atg12-RA 80..216 126..262 100 == Plus
Atg12-RA 217..321 281..385 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:24 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
Atg12-RB 1..469 1..469 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:44:51 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12136967..12137091 1..125 100 -> Plus
3L 12137159..12137295 126..262 100 -> Plus
3L 12137353..12137559 263..469 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:44:51 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12136967..12137091 1..125 100 -> Plus
3L 12137159..12137295 126..262 100 -> Plus
3L 12137353..12137559 263..469 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:44:51 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12136967..12137091 1..125 100 -> Plus
3L 12137159..12137295 126..262 100 -> Plus
3L 12137353..12137559 263..469 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:58 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12130067..12130191 1..125 100 -> Plus
arm_3L 12130259..12130395 126..262 100 -> Plus
arm_3L 12130453..12130659 263..469 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:55:05 Download gff for IP05205.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12130453..12130659 263..469 100   Plus
3L 12130067..12130191 1..125 100 -> Plus
3L 12130259..12130395 126..262 100 -> Plus

IP05205.hyp Sequence

Translation from 49 to 384

> IP05205.hyp
MAETPESQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNK
TVGWIQTFIHKFLKLDASEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKL
VLYYCKNQAWG*

IP05205.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:33:41
Subject Length Description Subject Range Query Range Score Percent Strand
Atg12-PB 111 CG10861-PB 1..111 1..111 594 100 Plus

IP05205.pep Sequence

Translation from 49 to 384

> IP05205.pep
MAETPESQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNK
TVGWIQTFIHKFLKLDASEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKL
VLYYCKNQAWG*

IP05205.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24802-PA 109 GF24802-PA 1..109 1..111 530 89.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16648-PA 65 GG16648-PA 26..65 72..111 225 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16151-PA 113 GH16151-PA 1..113 1..111 477 83.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
Atg12-PB 111 CG10861-PB 1..111 1..111 594 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12423-PA 114 GI12423-PA 1..114 1..111 486 81.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25155-PA 109 GL25155-PA 1..109 1..111 508 83.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23701-PA 109 GA23701-PA 1..109 1..111 508 83.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25329-PA 111 GM25329-PA 1..111 1..111 574 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14360-PA 111 GD14360-PA 1..111 1..111 583 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12318-PA 113 GJ12318-PA 1..113 1..111 492 86.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:48:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17547-PA 114 GK17547-PA 25..114 22..111 460 93.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:48:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21887-PA 65 GE21887-PA 26..65 72..111 224 100 Plus