BDGP Sequence Production Resources |
Search the DGRC for IP05205
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 52 |
Well: | 5 |
Vector: | pOT2 |
Associated Gene/Transcript | Atg12-RB |
Protein status: | IP05205.pep: gold |
Preliminary Size: | 357 |
Sequenced Size: | 494 |
Gene | Date | Evidence |
---|---|---|
CG10861 | 2005-01-01 | Successful iPCR screen |
Atg12 | 2008-04-29 | Release 5.5 accounting |
Atg12 | 2008-08-15 | Release 5.9 accounting |
Atg12 | 2008-12-18 | 5.12 accounting |
494 bp (494 high quality bases) assembled on 2005-03-06
GenBank Submission: BT022374
> IP05205.complete TTTTAATTCATTAATTAGGAACTATTTAATTTAGTTACATTCCAAATAAA TGGCAGAGACACCAGAATCCCAGGCAGCGCTGAGCACTTCCTCCTCCACA CCTGCAGATAAGGATGGTTCCAAAATTTGTATCCTTCTGAACGCCACTGG CAATGTGCCCATCATCAAAAAGCGAACCTGGACCGTAGATCCCAACAAGA CAGTCGGCTGGATACAGACGTTCATCCACAAGTTTCTGAAACTCGATGCC AGCGAGCAAATTTTCCTGTACGTTAATCAGACATTTGCACCTGCCCCGGA TCAGATAATCAAGAACTTGTACGAGTGCCATGGAACCAATGGGAAACTGG TGCTCTACTACTGCAAGAATCAGGCGTGGGGCTAAATCGATACGCACATG ACTTTGCTAAGTCTTAAGTATTTATTCGACTACTGTGTAATTTTTATATT ATTAAATGTGAATAAGATGAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 12128102..12128308 | 263..469 | 1035 | 100 | Plus |
chr3L | 24539361 | chr3L | 12127908..12128044 | 126..262 | 685 | 100 | Plus |
chr3L | 24539361 | chr3L | 12127716..12127840 | 1..125 | 625 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 12137353..12137560 | 263..470 | 1040 | 100 | Plus |
3L | 28110227 | 3L | 12137159..12137295 | 126..262 | 685 | 100 | Plus |
3L | 28110227 | 3L | 12136967..12137091 | 1..125 | 625 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 12130453..12130660 | 263..470 | 1040 | 100 | Plus |
3L | 28103327 | 3L | 12130259..12130395 | 126..262 | 685 | 100 | Plus |
3L | 28103327 | 3L | 12130067..12130191 | 1..125 | 625 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 12127716..12127840 | 1..125 | 100 | -> | Plus |
chr3L | 12127908..12128044 | 126..262 | 100 | -> | Plus |
chr3L | 12128102..12128308 | 263..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 1..336 | 50..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 1..336 | 50..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 1..336 | 50..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RA | 217..321 | 281..385 | 100 | Plus | |
Atg12-RA | 1..12 | 114..125 | 100 | -> | Plus |
Atg12-RA | 80..216 | 126..262 | 100 | == | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 1..336 | 50..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 194..662 | 1..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 194..662 | 1..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 1..469 | 1..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RA | 1..12 | 114..125 | 100 | -> | Plus |
Atg12-RA | 80..216 | 126..262 | 100 | == | Plus |
Atg12-RA | 217..321 | 281..385 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Atg12-RB | 1..469 | 1..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12136967..12137091 | 1..125 | 100 | -> | Plus |
3L | 12137159..12137295 | 126..262 | 100 | -> | Plus |
3L | 12137353..12137559 | 263..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12136967..12137091 | 1..125 | 100 | -> | Plus |
3L | 12137159..12137295 | 126..262 | 100 | -> | Plus |
3L | 12137353..12137559 | 263..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12136967..12137091 | 1..125 | 100 | -> | Plus |
3L | 12137159..12137295 | 126..262 | 100 | -> | Plus |
3L | 12137353..12137559 | 263..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 12130067..12130191 | 1..125 | 100 | -> | Plus |
arm_3L | 12130259..12130395 | 126..262 | 100 | -> | Plus |
arm_3L | 12130453..12130659 | 263..469 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 12130453..12130659 | 263..469 | 100 | Plus | |
3L | 12130067..12130191 | 1..125 | 100 | -> | Plus |
3L | 12130259..12130395 | 126..262 | 100 | -> | Plus |
Translation from 49 to 384
> IP05205.hyp MAETPESQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNK TVGWIQTFIHKFLKLDASEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKL VLYYCKNQAWG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Atg12-PB | 111 | CG10861-PB | 1..111 | 1..111 | 594 | 100 | Plus |
Translation from 49 to 384
> IP05205.pep MAETPESQAALSTSSSTPADKDGSKICILLNATGNVPIIKKRTWTVDPNK TVGWIQTFIHKFLKLDASEQIFLYVNQTFAPAPDQIIKNLYECHGTNGKL VLYYCKNQAWG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24802-PA | 109 | GF24802-PA | 1..109 | 1..111 | 530 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16648-PA | 65 | GG16648-PA | 26..65 | 72..111 | 225 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16151-PA | 113 | GH16151-PA | 1..113 | 1..111 | 477 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Atg12-PB | 111 | CG10861-PB | 1..111 | 1..111 | 594 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12423-PA | 114 | GI12423-PA | 1..114 | 1..111 | 486 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25155-PA | 109 | GL25155-PA | 1..109 | 1..111 | 508 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA23701-PA | 109 | GA23701-PA | 1..109 | 1..111 | 508 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25329-PA | 111 | GM25329-PA | 1..111 | 1..111 | 574 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14360-PA | 111 | GD14360-PA | 1..111 | 1..111 | 583 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12318-PA | 113 | GJ12318-PA | 1..113 | 1..111 | 492 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK17547-PA | 114 | GK17547-PA | 25..114 | 22..111 | 460 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21887-PA | 65 | GE21887-PA | 26..65 | 72..111 | 224 | 100 | Plus |