Clone IP05237 Report

Search the DGRC for IP05237

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:52
Well:37
Vector:pOT2
Associated Gene/TranscriptCG12912-RA
Protein status:IP05237.pep: gold
Preliminary Size:339
Sequenced Size:1129

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12912 2005-01-01 Successful iPCR screen
CG12912 2008-04-29 Release 5.5 accounting
CG12912 2008-08-15 Release 5.9 accounting
CG12912 2008-12-18 5.12 accounting

Clone Sequence Records

IP05237.complete Sequence

1129 bp (1129 high quality bases) assembled on 2006-08-03

GenBank Submission: BT028778

> IP05237.complete
CGCAGCTCCGGTCAGCTGCTTCGCAAAATCGACAAAAAGGAGTCACAAAA
AAACGCGCGCGGTGCATTTAGCCACAAATCTCTGAAAGTGAAAATACAAA
TATTGAAACAGTGAAATCCACAAACCAGCCAAAAGTGAAACAAAATTGAA
CACAGTGCTTAATTAATATCGAAGCTAAAGGGATAGAAATCCGATTAGGA
AAAGGGAAAGCTGCAGCGCTGCTCCTGTTTGCCAAATATTGATTCGCAAG
TGTGCCGCTGAAAAATCGATTATTAAAGCCACTTTCCACACAGCTGGTGG
TTGTTGTTGCCGTGAGGATGGAGGTGGTGCTTGGGGTGGTGGTTGCATAG
GGTTGCGTGCCGCGATGTGGGAAATCAACAGCAACATTGGCACATCCACA
TCCAGATCCAGAGGCACACTTCCAACTGTTTTGACGTGGTCGGGTTCCAA
TGGCGCTGACACTACCGAATGCTGCAGCGCAGCCTTGCAGCCATCCAGCG
GCGACGCGTTGCATGTGCAGCAGCAACAGCAACAGCAGCAGCAACATCAG
CAGCAGCAGCAGCAGCAACAGCAACAGCAGCAACAACAGCAGCAGCAGCA
GGATACGAAAACGAGGATGACAACGACCACAGGCAAACGCGGAGGACACA
GATACAGAAGCAGGCTCAGTCACCGAAGCACAGCAACAATTGCTGCATAT
TAGGCAGTAAAGTAAAGTTAAACACAACCCAAAACCGAAAAGACTAGCCC
AAAATTTACTCAAAAACCAACACAAGTGGAAAGCATTAATCGGAATGTCG
AACTCTATGCATCGCACAAAGTTACGTTAAGTATACGACGCGTATTTCCA
GCTGCAAAACGAACCAAAAACGAACCGAACGAAACGAAACGCACAGGTGC
ATCTGCAGACCCCACTACGCCCCTAAAAGCCCACTCCCCCCCCTTTTCGA
ACCCTCAGCCCCTCATTAGGCCACCCCCTCTGGGGTATCTACACCAATTG
ACAAGCAATCGAGGCAATGCAGTATGAATGAACTTGTTTAGTCGACAATT
TTTTAAGTGCACTTTCGTAAGGCTGATTTTCAATTTATTTCGATGTTGTG
CTTCTACACCCAAAAAAAAAAAAAAAAAA

IP05237.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12912-RA 339 CG12912-RA 1..339 365..703 1695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6121010..6122120 1111..1 5450 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10233456..10234576 1121..1 5605 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10234655..10235775 1121..1 5605 100 Minus
Blast to na_te.dros performed 2019-03-16 14:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 656..728 602..530 185 72.6 Minus
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 2027..2087 67..126 131 70.5 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 6444..6534 94..189 125 63.5 Plus

IP05237.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:02:27 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6121010..6121519 602..1111 99 == Minus
chr2R 6121605..6122120 1..516 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:23 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..339 365..703 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:50:19 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..339 365..703 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:41:29 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..339 365..703 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:05 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..339 365..703 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:22:10 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..339 365..703 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:23:45 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..339 365..703 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:50:19 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..1111 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:41:29 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RB 32..1142 1..1111 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:05 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
CG12912-RA 1..339 365..703 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:10 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
Hr46-RE 32..1142 1..1111 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:02:27 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10233466..10234576 1..1111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:02:27 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10233466..10234576 1..1111 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:02:27 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10233466..10234576 1..1111 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:41:29 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6120971..6122081 1..1111 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:09:30 Download gff for IP05237.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10234665..10235775 1..1111 100   Minus

IP05237.pep Sequence

Translation from 364 to 702

> IP05237.pep
MWEINSNIGTSTSRSRGTLPTVLTWSGSNGADTTECCSAALQPSSGDALH
VQQQQQQQQQHQQQQQQQQQQQQQQQQQQDTKTRMTTTTGKRGGHRYRSR
LSHRSTATIAAY*

IP05237.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19793-PA 125 GF19793-PA 27..121 16..110 137 57.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:53:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25224-PA 157 GG25224-PA 31..157 1..112 299 75.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12912-PB 112 CG12912-PB 1..112 1..112 585 100 Plus
CG12912-PA 112 CG12912-PA 1..112 1..112 585 100 Plus
CHES-1-like-PC 1267 CG12690-PC 256..334 21..97 158 50.6 Plus
CHES-1-like-PD 1268 CG12690-PD 256..334 21..97 158 50.6 Plus
CHES-1-like-PB 1268 CG12690-PB 256..334 21..97 158 50.6 Plus
CHES-1-like-PA 1268 CG12690-PA 256..334 21..97 158 50.6 Plus
dl-PB 677 CG6667-PB 479..537 53..111 150 54.2 Plus
dl-PA 677 CG6667-PA 479..537 53..111 150 54.2 Plus
dl-PE 677 CG6667-PE 479..537 53..111 150 54.2 Plus
dl-PD 677 CG6667-PD 479..537 53..111 150 54.2 Plus
sbb-PH 2302 CG5580-PH 1933..1988 50..105 148 55.4 Plus
sbb-PD 2302 CG5580-PD 1933..1988 50..105 148 55.4 Plus
sbb-PG 2312 CG5580-PG 1943..1998 50..105 148 55.4 Plus
sbb-PJ 2330 CG5580-PJ 1943..1998 50..105 148 55.4 Plus
mask-PF 3623 CG33106-PF 807..836 50..79 144 93.3 Plus
mask-PD 3636 CG33106-PD 820..849 50..79 144 93.3 Plus
mask-PE 4000 CG33106-PE 1185..1214 50..79 144 93.3 Plus
mask-PB 4001 CG33106-PB 1185..1214 50..79 144 93.3 Plus
mask-PA 4001 CG33106-PA 1185..1214 50..79 144 93.3 Plus
mask-PC 4010 CG33106-PC 1197..1226 50..79 144 93.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:53:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10485-PA 101 GL10485-PA 1..53 1..55 172 67.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:54:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11903-PA 104 GA11903-PA 1..87 1..107 179 47.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20544-PA 138 GM20544-PA 31..138 1..112 499 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD26000-PA 142 GD26000-PA 31..142 1..112 527 96.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21699-PA 109 GE21699-PA 1..109 1..112 336 92.9 Plus

IP05237.hyp Sequence

Translation from 364 to 702

> IP05237.hyp
MWEINSNIGTSTSRSRGTLPTVLTWSGSNGADTTECCSAALQPSSGDALH
VQQQQQQQQQHQQQQQQQQQQQQQQQQQQDTKTRMTTTTGKRGGHRYRSR
LSHRSTATIAAY*

IP05237.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG12912-PB 112 CG12912-PB 1..112 1..112 585 100 Plus
CG12912-PA 112 CG12912-PA 1..112 1..112 585 100 Plus
CHES-1-like-PC 1267 CG12690-PC 256..334 21..97 158 50.6 Plus
CHES-1-like-PD 1268 CG12690-PD 256..334 21..97 158 50.6 Plus
CHES-1-like-PB 1268 CG12690-PB 256..334 21..97 158 50.6 Plus