Clone IP05243 Report

Search the DGRC for IP05243

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:52
Well:43
Vector:pOT2
Associated Gene/TranscriptCG13042-RA
Protein status:IP05243.pep: gold
Preliminary Size:354
Sequenced Size:592

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13042 2005-01-01 Successful iPCR screen
CG13042 2008-04-29 Release 5.5 accounting
CG13042 2008-08-15 Release 5.9 accounting
CG13042 2008-12-18 5.12 accounting

Clone Sequence Records

IP05243.complete Sequence

592 bp (592 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023651

> IP05243.complete
ACACAGACCAACAGTTCAGTAGTTCAGCCAATAGCTAGCGCACCAGGATC
GCAAGGATTAGCAAAATGTACAAGTTGGTGGTGTTCTTCGCTCTGCTCGC
CGTCGTGGCTGCCCGTCCGGGTTATTTGGAGTCTGGTCCACTGCTCCACA
GCTATGCCGCTCCTGCCATCATCCATGAACCGGCTCTGGCCAAGGTGGGC
GCCATCATCAAGACCGTGCCCAGTGCCGTCTCCCACCAGAGCATCAGCCA
GGTGCACAGCTCGGCCCACATCATCCAACCGATTGTGGCTCCGGTGGTGA
AGACCTATGCCGCTCCCATCATCAAGACTTATGCGGCTCCTGCCCTCCAC
ACGACCCTCCTCTCGTCTCCGTGGGCCGGACATGGTTGGGCTGGCCATGG
CTGGGCTCCGTCCTGGTAAATGTGATGGAGGTCCTGGATGGCATTGCGTG
GGCTAGCAACTTTGGCTTACCCTCACCTCGATCCCATGCTTAAACTCTCA
ACCCTGCTGTTTTGTTTTTCTTCTTTCACATTTCGACTGATGTAAATAAA
TCCATGTTTCATGCTCAAAATAAAAAAAAAAAAAAAAAAAAA

IP05243.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13042-RA 726 CG13042-RA 124..696 1..573 2865 100 Plus
CG13043-RA 645 CG13043-RA 182..258 166..242 175 81.8 Plus
CG13043-RA 645 CG13043-RA 72..132 62..122 155 83.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16297573..16298067 571..77 2400 99 Minus
chr3L 24539361 chr3L 16298128..16298207 80..1 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16307844..16308340 573..77 2485 100 Minus
3L 28110227 3L 16308401..16308480 80..1 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16300944..16301440 573..77 2485 100 Minus
3L 28103327 3L 16301501..16301580 80..1 400 100 Minus
3L 28103327 3L 16298709..16298785 242..166 175 81.8 Minus
3L 28103327 3L 16295951..16296039 260..172 175 79.7 Minus
3L 28103327 3L 16298835..16298895 122..62 155 83.6 Minus
Blast to na_te.dros performed on 2019-03-16 17:56:42 has no hits.

IP05243.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:57:23 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16297573..16298066 78..571 98 <- Minus
chr3L 16298131..16298207 1..77 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:25 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:32 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:32 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:00 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:23:55 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:51 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:32 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:32 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..571 1..571 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:01 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..354 66..419 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:23:55 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
CG13042-RA 1..571 1..571 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:23 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16307846..16308339 78..571 100 <- Minus
3L 16308404..16308480 1..77 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:23 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16307846..16308339 78..571 100 <- Minus
3L 16308404..16308480 1..77 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:23 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16307846..16308339 78..571 100 <- Minus
3L 16308404..16308480 1..77 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:32 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16300946..16301439 78..571 100 <- Minus
arm_3L 16301504..16301580 1..77 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:31 Download gff for IP05243.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16300946..16301439 78..571 100 <- Minus
3L 16301504..16301580 1..77 100   Minus

IP05243.hyp Sequence

Translation from 65 to 418

> IP05243.hyp
MYKLVVFFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKT
VPSAVSHQSISQVHSSAHIIQPIVAPVVKTYAAPIIKTYAAPALHTTLLS
SPWAGHGWAGHGWAPSW*

IP05243.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13042-PA 117 CG13042-PA 1..117 1..117 611 100 Plus
CG13043-PA 148 CG13043-PA 1..103 1..102 270 57.9 Plus
CG13044-PA 155 CG13044-PA 1..119 1..109 245 50 Plus
CG13063-PA 129 CG13063-PA 1..102 1..102 243 50 Plus
CG13041-PA 124 CG13041-PA 1..87 1..96 206 46.9 Plus

IP05243.pep Sequence

Translation from 65 to 418

> IP05243.pep
MYKLVVFFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKT
VPSAVSHQSISQVHSSAHIIQPIVAPVVKTYAAPIIKTYAAPALHTTLLS
SPWAGHGWAGHGWAPSW*

IP05243.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:08:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10297-PA 112 GF10297-PA 1..112 1..117 494 88 Plus
Dana\GF24178-PA 138 GF24178-PA 1..112 1..110 279 57 Plus
Dana\GF10299-PA 158 GF10299-PA 1..66 1..66 201 60.6 Plus
Dana\GF10298-PA 145 GF10298-PA 1..110 1..97 198 58 Plus
Dana\GF24181-PA 136 GF24181-PA 1..69 1..80 167 51.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13469-PA 117 GG13469-PA 1..117 1..117 566 99.1 Plus
Dere\GG15985-PA 136 GG15985-PA 1..77 1..94 174 45.7 Plus
Dere\GG13467-PA 136 GG13467-PA 1..69 1..80 167 50 Plus
Dere\GG13470-PA 147 GG13470-PA 1..113 1..102 162 56.5 Plus
Dere\GG13471-PA 155 GG13471-PA 1..67 1..66 154 59.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15607-PA 111 GH15607-PA 1..110 1..110 391 79.1 Plus
Dgri\GH15608-PA 163 GH15608-PA 1..108 1..97 196 56.4 Plus
Dgri\GH15610-PA 166 GH15610-PA 1..65 1..66 170 65.2 Plus
Dgri\GH15606-PA 114 GH15606-PA 1..69 1..80 159 48.8 Plus
Dgri\GH15877-PA 123 GH15877-PA 1..69 1..80 152 48.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13042-PA 117 CG13042-PA 1..117 1..117 611 100 Plus
CG13043-PA 148 CG13043-PA 1..103 1..102 270 57.9 Plus
CG13044-PA 155 CG13044-PA 1..119 1..109 245 50 Plus
CG13063-PA 129 CG13063-PA 1..102 1..102 243 50 Plus
CG13041-PA 124 CG13041-PA 1..87 1..96 206 46.9 Plus
CG13060-PA 131 CG13060-PA 1..87 1..96 202 45.9 Plus
CG13040-PB 185 CG13040-PB 1..78 1..90 151 38.9 Plus
CG13040-PA 185 CG13040-PA 1..78 1..90 151 38.9 Plus
CG13040-PB 185 CG13040-PB 114..183 21..89 138 44.6 Plus
CG13040-PA 185 CG13040-PA 114..183 21..89 138 44.6 Plus
CG13059-PA 155 CG13059-PA 1..108 1..102 138 40.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16883-PA 112 GI16883-PA 1..110 1..110 389 81.8 Plus
Dmoj\GI16885-PA 140 GI16885-PA 1..106 1..97 196 56.5 Plus
Dmoj\GI16886-PA 146 GI16886-PA 1..65 1..66 166 63.6 Plus
Dmoj\GI16526-PA 111 GI16526-PA 1..69 1..80 148 50 Plus
Dmoj\GI12653-PA 111 GI12653-PA 1..69 1..80 148 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:08:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18009-PA 110 GL18009-PA 1..110 1..117 435 82.9 Plus
Dper\GL17989-PA 120 GL17989-PA 1..103 1..101 235 61 Plus
Dper\GL17864-PA 120 GL17864-PA 1..102 1..100 231 60.6 Plus
Dper\GL17848-PA 120 GL17848-PA 1..102 1..100 230 59.6 Plus
Dper\GL18010-PA 142 GL18010-PA 1..102 1..97 172 60.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11996-PA 110 GA11996-PA 1..110 1..117 435 82.9 Plus
Dpse\GA28521-PA 120 GA28521-PA 1..102 1..100 231 60.6 Plus
Dpse\GA28359-PA 120 GA28359-PA 1..102 1..100 231 60.6 Plus
Dpse\GA28511-PA 120 GA28511-PA 1..102 1..100 227 58.7 Plus
Dpse\GA11997-PA 142 GA11997-PA 1..96 1..93 170 63.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:08:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24418-PA 117 GM24418-PA 1..117 1..117 569 100 Plus
Dsec\GM24416-PA 136 GM24416-PA 1..69 1..80 167 50 Plus
Dsec\GM25617-PA 136 GM25617-PA 1..69 1..80 165 48.8 Plus
Dsec\GM24419-PA 148 GM24419-PA 1..119 1..97 161 53.7 Plus
Dsec\GM24420-PA 155 GM24420-PA 1..67 1..66 154 59.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12488-PA 117 GD12488-PA 1..117 1..117 569 100 Plus
Dsim\GD12487-PA 136 GD12487-PA 1..69 1..80 167 50 Plus
Dsim\GD14622-PA 133 GD14622-PA 1..69 1..80 165 48.8 Plus
Dsim\GD12490-PA 155 GD12490-PA 1..67 1..66 154 59.4 Plus
Dsim\GD14619-PA 129 GD14619-PA 1..116 1..97 152 47.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12632-PA 113 GJ12632-PA 1..111 1..110 383 81.1 Plus
Dvir\GJ12633-PA 170 GJ12633-PA 1..108 1..97 199 56.5 Plus
Dvir\GJ12634-PA 152 GJ12634-PA 1..65 1..66 160 62.1 Plus
Dvir\GJ12631-PA 123 GJ12631-PA 1..69 1..80 143 47.5 Plus
Dvir\GJ12779-PA 115 GJ12779-PA 1..69 1..80 141 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17641-PA 115 GK17641-PA 1..115 1..117 456 82.4 Plus
Dwil\GK17642-PA 147 GK17642-PA 1..123 1..97 165 52.8 Plus
Dwil\GK16560-PA 128 GK16560-PA 1..72 1..82 164 43.9 Plus
Dwil\GK17643-PA 148 GK17643-PA 38..95 36..90 159 61 Plus
Dwil\GK17640-PA 128 GK17640-PA 26..72 35..82 151 62.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22801-PA 117 GE22801-PA 1..117 1..117 566 99.1 Plus
Dyak\GE22899-PA 99 GE22899-PA 2..99 20..117 457 96.9 Plus
Dyak\GE23097-PA 129 GE23097-PA 1..116 1..97 221 47.5 Plus
Dyak\GE19548-PA 136 GE19548-PA 1..69 1..80 166 48.8 Plus
Dyak\GE23111-PA 136 GE23111-PA 1..69 1..80 162 47.5 Plus