Clone IP05252 Report

Search the DGRC for IP05252

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:52
Well:52
Vector:pOT2
Associated Gene/TranscriptCG13171-RA
Protein status:IP05252.pep: gold
Preliminary Size:321
Sequenced Size:415

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13171 2005-01-01 Successful iPCR screen
CG13171 2008-04-29 Release 5.5 accounting
CG13171 2008-08-15 Release 5.9 accounting
CG13171 2008-12-18 5.12 accounting

Clone Sequence Records

IP05252.complete Sequence

415 bp (415 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023652

> IP05252.complete
GAACCTAGTATGTGTACGTATTTCAAATGTCTGCCTTTAAAATTGCTTAT
GCCTGTCGTTATTGTGGCAATATCGTCAGCTACAAGTCAGCCAAAGTGAA
TGAGACGCCCTACGACTTGCTCCTGAGCCGTACCTTCAACCTAATCCAAG
AGGACAGGATCAGGGAGACAAATGGGGAGCGATTCCAGAATCTGCACTGC
TCCAAGTGCCGCATGGAACTGGGTCTGCTGTGCTTGCAGAGCGAAAGGAA
TGTCCAACTGAAGGGACTTTCGCTGTTGGAGAAGGTTCATCTGGTGGTGT
ACGACTCGTACGAGGTGCCATTCGAGATGGCCTCACTTCGTGACTGATGA
AGCGTGTGGAAATAAAGTTTGAGGGAAAACAATTAACAATTTAAAAAAAA
AAAAAAAAAAAAAAA

IP05252.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13171-RA 392 CG13171-RA 1..392 1..392 1960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8101219..8101610 1..392 1960 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12214004..12214397 1..394 1970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12215203..12215596 1..394 1970 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:02:33 has no hits.

IP05252.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:03:33 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8101219..8101610 1..392 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:26 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..321 27..347 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:44 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..321 27..347 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:01:58 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..321 27..347 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:20:06 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..321 27..347 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:41 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..321 27..347 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:47:48 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..321 27..347 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:44 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..392 1..392 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:01:58 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..392 1..392 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:20:06 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..321 27..347 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:41 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13171-RA 1..386 7..392 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:33 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12214004..12214395 1..392 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:33 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12214004..12214395 1..392 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:33 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12214004..12214395 1..392 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:01:58 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8101509..8101900 1..392 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:55:04 Download gff for IP05252.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12215203..12215594 1..392 100   Plus

IP05252.pep Sequence

Translation from 26 to 346

> IP05252.pep
MSAFKIAYACRYCGNIVSYKSAKVNETPYDLLLSRTFNLIQEDRIRETNG
ERFQNLHCSKCRMELGLLCLQSERNVQLKGLSLLEKVHLVVYDSYEVPFE
MASLRD*

IP05252.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12830-PA 102 GF12830-PA 1..101 1..101 364 67.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20260-PA 106 GG20260-PA 1..106 1..106 494 84.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13171-PA 106 CG13171-PA 1..106 1..106 550 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21346-PA 106 GM21346-PA 1..106 1..106 552 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15409-PA 106 GD15409-PA 1..106 1..106 558 100 Plus
Dsim\GD15408-PA 124 GD15408-PA 35..124 17..106 460 96.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19419-PA 109 GK19419-PA 1..106 1..101 238 47.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12419-PA 102 GE12419-PA 1..102 1..102 520 94.1 Plus

IP05252.hyp Sequence

Translation from 26 to 346

> IP05252.hyp
MSAFKIAYACRYCGNIVSYKSAKVNETPYDLLLSRTFNLIQEDRIRETNG
ERFQNLHCSKCRMELGLLCLQSERNVQLKGLSLLEKVHLVVYDSYEVPFE
MASLRD*

IP05252.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13171-PA 106 CG13171-PA 1..106 1..106 550 100 Plus