IP05252.complete Sequence
415 bp (415 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023652
> IP05252.complete
GAACCTAGTATGTGTACGTATTTCAAATGTCTGCCTTTAAAATTGCTTAT
GCCTGTCGTTATTGTGGCAATATCGTCAGCTACAAGTCAGCCAAAGTGAA
TGAGACGCCCTACGACTTGCTCCTGAGCCGTACCTTCAACCTAATCCAAG
AGGACAGGATCAGGGAGACAAATGGGGAGCGATTCCAGAATCTGCACTGC
TCCAAGTGCCGCATGGAACTGGGTCTGCTGTGCTTGCAGAGCGAAAGGAA
TGTCCAACTGAAGGGACTTTCGCTGTTGGAGAAGGTTCATCTGGTGGTGT
ACGACTCGTACGAGGTGCCATTCGAGATGGCCTCACTTCGTGACTGATGA
AGCGTGTGGAAATAAAGTTTGAGGGAAAACAATTAACAATTTAAAAAAAA
AAAAAAAAAAAAAAA
IP05252.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:47:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13171-RA | 392 | CG13171-RA | 1..392 | 1..392 | 1960 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:02:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 8101219..8101610 | 1..392 | 1960 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:02:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12214004..12214397 | 1..394 | 1970 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:07:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 12215203..12215596 | 1..394 | 1970 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 20:02:33 has no hits.
IP05252.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:03:33 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 8101219..8101610 | 1..392 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:26 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..321 | 27..347 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:41:44 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..321 | 27..347 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:01:58 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..321 | 27..347 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:20:06 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..321 | 27..347 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:27:41 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..321 | 27..347 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:47:48 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..321 | 27..347 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:41:44 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..392 | 1..392 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:01:58 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..392 | 1..392 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:20:06 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..321 | 27..347 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:27:41 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13171-RA | 1..386 | 7..392 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:33 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12214004..12214395 | 1..392 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:33 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12214004..12214395 | 1..392 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:03:33 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12214004..12214395 | 1..392 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:01:58 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8101509..8101900 | 1..392 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:55:04 Download gff for
IP05252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12215203..12215594 | 1..392 | 100 | | Plus |
IP05252.pep Sequence
Translation from 26 to 346
> IP05252.pep
MSAFKIAYACRYCGNIVSYKSAKVNETPYDLLLSRTFNLIQEDRIRETNG
ERFQNLHCSKCRMELGLLCLQSERNVQLKGLSLLEKVHLVVYDSYEVPFE
MASLRD*
IP05252.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:19:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12830-PA | 102 | GF12830-PA | 1..101 | 1..101 | 364 | 67.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:19:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20260-PA | 106 | GG20260-PA | 1..106 | 1..106 | 494 | 84.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13171-PA | 106 | CG13171-PA | 1..106 | 1..106 | 550 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:19:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21346-PA | 106 | GM21346-PA | 1..106 | 1..106 | 552 | 99.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:19:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD15409-PA | 106 | GD15409-PA | 1..106 | 1..106 | 558 | 100 | Plus |
Dsim\GD15408-PA | 124 | GD15408-PA | 35..124 | 17..106 | 460 | 96.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:19:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19419-PA | 109 | GK19419-PA | 1..106 | 1..101 | 238 | 47.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:19:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12419-PA | 102 | GE12419-PA | 1..102 | 1..102 | 520 | 94.1 | Plus |
IP05252.hyp Sequence
Translation from 26 to 346
> IP05252.hyp
MSAFKIAYACRYCGNIVSYKSAKVNETPYDLLLSRTFNLIQEDRIRETNG
ERFQNLHCSKCRMELGLLCLQSERNVQLKGLSLLEKVHLVVYDSYEVPFE
MASLRD*
IP05252.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13171-PA | 106 | CG13171-PA | 1..106 | 1..106 | 550 | 100 | Plus |