Clone IP05263 Report

Search the DGRC for IP05263

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:52
Well:63
Vector:pOT2
Associated Gene/TranscriptCG42758-RA
Protein status:IP05263.pep: gold
Preliminary Size:350
Sequenced Size:641

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13479 2005-01-01 Successful iPCR screen

Clone Sequence Records

IP05263.complete Sequence

641 bp (641 high quality bases) assembled on 2005-03-06

GenBank Submission: BT022385

> IP05263.complete
CGACGAAGCTAGCTATTTTCGTTTGTGTATTTTCATGCCTGGACAATCAG
CGATGAATGTATAAGGCGAAAATATACAGTTTCTTCGGGATATCTTTTAG
AATAAAAAATTGTGTATAAGCTCCGCTGTTACACTTCCTTCCACCAACGA
GTCTCAAAAATATCTGTGGACCATGTGCATGCAAGTTCCACGGTTTGGAT
GTCGAGTTCCAGTTTCCAGTTCCCGTTGTAAGACCGGTGCAACCAGATCT
TGTCGAAAGCCCGGATCTCGCTACAGAACCTTCTGCACTCCACCACCTCG
CTGTAGTCCCAGATCCTGCTGCACATCCGAATCCTGCTGCAAATCCGGGT
CCTGCTGCGGACCATGTGGGTCATGCTCGAATGGCTGTGCCGCCTGCTTA
TCCTCCTGCTGTGGGATATTCCCCGAAACCTGCTGTGGTCCGTGGTGTGA
GTCCTGTCTGGATCCTTCCTGGTTCTCATGGCTGGCTCCCGATCTCGGGC
GATCCTGCTGTTGTGCTTGCATGACCTGTTGTCGATCCAAGTGCTGATGA
AATATGGATAGTGGAAAGTCGTTGTGAACAAATCAATTGTAAAAAAAATT
CAATTTTTAATTTAATTTGAATTAAAAAAAAAAAAAAAAAA

IP05263.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
MB6.chr3L.pasa.7444.a 656 MB6.chr3L.pasa.7444.a 34..636 1..603 3015 100 Plus
CG13479-RA 350 CG13479-RA 18..350 603..271 1665 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14557654..14558220 37..603 2820 99.8 Plus
chr3L 24539361 chr3L 14557555..14557591 1..37 185 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14567547..14568113 37..603 2835 100 Plus
3L 28110227 3L 14567448..14567484 1..37 185 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14560647..14561213 37..603 2835 100 Plus
3L 28103327 3L 14560548..14560584 1..37 185 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:08:05 has no hits.

IP05263.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:09:20 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14557555..14557590 1..36 100 -> Plus
chr3L 14557654..14558205 37..588 99 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:17 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 1..375 173..547 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:40 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 1..375 173..547 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:21 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG6623-RA 52..72 298..318 95   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:02 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 1..375 173..547 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:20:44 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG13479-RA 7..350 271..615 98   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:17 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 9..621 1..615 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:40 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 9..621 1..615 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:21 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG13479-RA 7..350 271..615 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:02 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
CG42758-RA 9..621 1..615 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:20 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14567448..14567483 1..36 100 -> Plus
3L 14567547..14568113 37..603 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:20 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14567448..14567483 1..36 100 -> Plus
3L 14567547..14568113 37..603 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:20 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14567448..14567483 1..36 100 -> Plus
3L 14567547..14568113 37..603 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:40 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14560548..14560583 1..36 100 -> Plus
arm_3L 14560647..14561213 37..603 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:40:30 Download gff for IP05263.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14560647..14561213 37..603 100 -> Plus
3L 14560548..14560583 1..36 100 -> Plus

IP05263.pep Sequence

Translation from 172 to 546

> IP05263.pep
MCMQVPRFGCRVPVSSSRCKTGATRSCRKPGSRYRTFCTPPPRCSPRSCC
TSESCCKSGSCCGPCGSCSNGCAACLSSCCGIFPETCCGPWCESCLDPSW
FSWLAPDLGRSCCCACMTCCRSKC*

IP05263.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-PA 124 CG42758-PA 1..124 1..124 764 100 Plus
Pif2-PA 118 CG31483-PA 2..69 44..124 160 42 Plus
Pif2-PA 118 CG31483-PA 18..117 38..124 137 35 Plus

IP05263.hyp Sequence

Translation from 172 to 546

> IP05263.hyp
MCMQVPRFGCRVPVSSSRCKTGATRSCRKPGSRYRTFCTPPPRCSPRSCC
TSESCCKSGSCCGPCGSCSNGCAACLSSCCGIFPETCCGPWCESCLDPSW
FSWLAPDLGRSCCCACMTCCRSKC*

IP05263.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42758-PA 124 CG42758-PA 1..124 1..124 764 100 Plus
Pif2-PA 118 CG31483-PA 2..69 44..124 160 42 Plus
Pif2-PA 118 CG31483-PA 18..117 38..124 137 35 Plus