Clone IP05301 Report

Search the DGRC for IP05301

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:53
Well:1
Vector:pOT2
Associated Gene/TranscriptCG10674-RA
Protein status:IP05301.pep: gold
Preliminary Size:327
Sequenced Size:495

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10674 2005-01-01 Successful iPCR screen
CG10674 2008-04-29 Release 5.5 accounting
CG10674 2008-08-15 Release 5.9 accounting
CG10674 2008-12-18 5.12 accounting

Clone Sequence Records

IP05301.complete Sequence

495 bp (495 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023649

> IP05301.complete
ATCCATTGCAATCTGACCTGGTTTTTCGATTAAATTGGTGAAAATTAAAT
AAATTAAAAATGAACATGACCGTGGATCCGCGCCGCAAGGAGAAGATCAA
CCGCTACAAGGCGCCCAAGAACCAGGGCCAGAGCGGCGGCGCCAACGAGG
ACATGATGCCGGATTACATGAACATTCTGGGCATGATTTTCTCCATGTGT
GGACTGATGATGAAGCTCAAGTGGTGCGCCTGGTTTGCGCTGTACTGCTC
CTGCATTAGTTTCGCCAGTTCTCGGGCCAGCGACGATGCCAAACAGGTGC
TCTCCTCCTTTATGTTGAGCGTCAGTGCGGTGGTGATGTCCTACCTCCAG
AATCCCGCTGCCATGACCCCACCATGGGCTTCCTAGCACTGGACCTAAGA
TAACTATTTTAAATTTAATGTAATTGAACAGTTGAGAGCCTCGGTTTTGT
TCGACGCTCAGTAAAAAAGTACGTACGTAAAAAAAAAAAAAAAAA

IP05301.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG10674-RA 642 CG10674-RA 92..570 1..479 2395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5128304..5128568 478..214 1295 99.2 Minus
chr3L 24539361 chr3L 5128634..5128848 215..1 1075 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5135747..5136012 479..214 1330 100 Minus
3L 28110227 3L 5136078..5136292 215..1 1075 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5128847..5129112 479..214 1330 100 Minus
3L 28103327 3L 5129178..5129392 215..1 1075 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:43:29 has no hits.

IP05301.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:44:46 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5128304..5128566 216..478 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:35 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..327 60..386 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:33 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..327 60..386 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:37:16 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..327 60..386 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:01 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..327 60..386 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:13:25 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..327 60..386 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:52 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..327 60..386 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:33 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..478 1..478 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:37:16 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..478 1..478 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:02 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..327 60..386 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:13:25 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
CG10674-RA 1..478 1..478 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:46 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5135748..5136010 216..478 100 <- Minus
3L 5136078..5136292 1..215 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:46 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5135748..5136010 216..478 100 <- Minus
3L 5136078..5136292 1..215 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:44:46 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5135748..5136010 216..478 100 <- Minus
3L 5136078..5136292 1..215 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:37:16 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5128848..5129110 216..478 100 <- Minus
arm_3L 5129178..5129392 1..215 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:33 Download gff for IP05301.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5128848..5129110 216..478 100 <- Minus
3L 5129178..5129392 1..215 100   Minus

IP05301.hyp Sequence

Translation from 59 to 385

> IP05301.hyp
MNMTVDPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLM
MKLKWCAWFALYCSCISFASSRASDDAKQVLSSFMLSVSAVVMSYLQNPA
AMTPPWAS*

IP05301.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG10674-PA 108 CG10674-PA 1..108 1..108 574 100 Plus

IP05301.pep Sequence

Translation from 59 to 385

> IP05301.pep
MNMTVDPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLM
MKLKWCAWFALYCSCISFASSRASDDAKQVLSSFMLSVSAVVMSYLQNPA
AMTPPWAS*

IP05301.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10475-PA 108 GF10475-PA 1..108 1..108 547 95.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14145-PA 108 GG14145-PA 1..108 1..108 563 98.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15278-PA 108 GH15278-PA 1..108 1..108 546 95.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG10674-PA 108 CG10674-PA 1..108 1..108 574 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11987-PA 108 GI11987-PA 1..108 1..108 553 96.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22472-PA 108 GL22472-PA 1..108 1..108 551 96.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:08:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10485-PA 108 GA10485-PA 1..108 1..108 551 96.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13932-PA 108 GM13932-PA 1..108 1..108 567 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:08:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13213-PA 108 GD13213-PA 1..108 1..108 567 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12211-PA 108 GJ12211-PA 1..108 1..108 552 96.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:08:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19814-PA 107 GK19814-PA 1..107 1..108 538 95.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20574-PA 108 GE20574-PA 1..108 1..108 563 98.1 Plus