BDGP Sequence Production Resources |
Search the DGRC for IP05301
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 53 |
Well: | 1 |
Vector: | pOT2 |
Associated Gene/Transcript | CG10674-RA |
Protein status: | IP05301.pep: gold |
Preliminary Size: | 327 |
Sequenced Size: | 495 |
Gene | Date | Evidence |
---|---|---|
CG10674 | 2005-01-01 | Successful iPCR screen |
CG10674 | 2008-04-29 | Release 5.5 accounting |
CG10674 | 2008-08-15 | Release 5.9 accounting |
CG10674 | 2008-12-18 | 5.12 accounting |
495 bp (495 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023649
> IP05301.complete ATCCATTGCAATCTGACCTGGTTTTTCGATTAAATTGGTGAAAATTAAAT AAATTAAAAATGAACATGACCGTGGATCCGCGCCGCAAGGAGAAGATCAA CCGCTACAAGGCGCCCAAGAACCAGGGCCAGAGCGGCGGCGCCAACGAGG ACATGATGCCGGATTACATGAACATTCTGGGCATGATTTTCTCCATGTGT GGACTGATGATGAAGCTCAAGTGGTGCGCCTGGTTTGCGCTGTACTGCTC CTGCATTAGTTTCGCCAGTTCTCGGGCCAGCGACGATGCCAAACAGGTGC TCTCCTCCTTTATGTTGAGCGTCAGTGCGGTGGTGATGTCCTACCTCCAG AATCCCGCTGCCATGACCCCACCATGGGCTTCCTAGCACTGGACCTAAGA TAACTATTTTAAATTTAATGTAATTGAACAGTTGAGAGCCTCGGTTTTGT TCGACGCTCAGTAAAAAAGTACGTACGTAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10674-RA | 642 | CG10674-RA | 92..570 | 1..479 | 2395 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 5128304..5128566 | 216..478 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..327 | 60..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..327 | 60..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..327 | 60..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..327 | 60..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..327 | 60..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..327 | 60..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..478 | 1..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..478 | 1..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..327 | 60..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10674-RA | 1..478 | 1..478 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5135748..5136010 | 216..478 | 100 | <- | Minus |
3L | 5136078..5136292 | 1..215 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5135748..5136010 | 216..478 | 100 | <- | Minus |
3L | 5136078..5136292 | 1..215 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5135748..5136010 | 216..478 | 100 | <- | Minus |
3L | 5136078..5136292 | 1..215 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 5128848..5129110 | 216..478 | 100 | <- | Minus |
arm_3L | 5129178..5129392 | 1..215 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5128848..5129110 | 216..478 | 100 | <- | Minus |
3L | 5129178..5129392 | 1..215 | 100 | Minus |
Translation from 59 to 385
> IP05301.hyp MNMTVDPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLM MKLKWCAWFALYCSCISFASSRASDDAKQVLSSFMLSVSAVVMSYLQNPA AMTPPWAS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10674-PA | 108 | CG10674-PA | 1..108 | 1..108 | 574 | 100 | Plus |
Translation from 59 to 385
> IP05301.pep MNMTVDPRRKEKINRYKAPKNQGQSGGANEDMMPDYMNILGMIFSMCGLM MKLKWCAWFALYCSCISFASSRASDDAKQVLSSFMLSVSAVVMSYLQNPA AMTPPWAS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10475-PA | 108 | GF10475-PA | 1..108 | 1..108 | 547 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14145-PA | 108 | GG14145-PA | 1..108 | 1..108 | 563 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15278-PA | 108 | GH15278-PA | 1..108 | 1..108 | 546 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10674-PA | 108 | CG10674-PA | 1..108 | 1..108 | 574 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11987-PA | 108 | GI11987-PA | 1..108 | 1..108 | 553 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22472-PA | 108 | GL22472-PA | 1..108 | 1..108 | 551 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10485-PA | 108 | GA10485-PA | 1..108 | 1..108 | 551 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13932-PA | 108 | GM13932-PA | 1..108 | 1..108 | 567 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13213-PA | 108 | GD13213-PA | 1..108 | 1..108 | 567 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12211-PA | 108 | GJ12211-PA | 1..108 | 1..108 | 552 | 96.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19814-PA | 107 | GK19814-PA | 1..107 | 1..108 | 538 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20574-PA | 108 | GE20574-PA | 1..108 | 1..108 | 563 | 98.1 | Plus |