Clone IP05304 Report

Search the DGRC for IP05304

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:53
Well:4
Vector:pOT2
Associated Gene/TranscriptCG10834-RA
Protein status:IP05304.pep: gold
Preliminary Size:294
Sequenced Size:437

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10834 2005-01-01 Successful iPCR screen
CG10834 2008-04-29 Release 5.5 accounting
CG10834 2008-08-15 Release 5.9 accounting
CG10834 2008-12-18 5.12 accounting

Clone Sequence Records

IP05304.complete Sequence

437 bp (437 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023650

> IP05304.complete
ATTACATTTAAAAGTACACTACTGTCCTATATATAATGTCCGCGGAAATC
GAGGATTTGCTGAAACGCTATCAAAACTACCCCAATGTTTCTGGCATAAT
TATTTTGGACCCGTTCGCTATACCAATCAAGACCACCATGGAGTACACCT
TGACCGTGCATTACGCGGCCTTGATCAGCACCTTAACTTATAAGGCGGCC
AAAATGATTACCAATTTGGATGCCAGCAATGAGCTGGTGACAATACGTCT
GCGCACCAAGGTTCACGAGGTGATTGTGCTGCCCTCCGAGAACTACATCA
TTATTGTAGTGCAAAATCCAGGCACCTAAATCATTGTATTAAGCCATGTA
ATATTCTTTTTCGCTGAATGTATTTGCCCTTATATAGTTTTAATTAAAGT
TGAGAAAGCGTCTGGTCCAAAAAAAAAAAAAAAAAAA

IP05304.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-RA 420 CG10834-RA 1..420 1..420 2100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 22105387..22105804 418..1 2075 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22106860..22107279 420..1 2100 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 22106860..22107279 420..1 2100 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:46:50 has no hits.

IP05304.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:47:42 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 22105387..22105804 1..418 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:37 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..294 36..329 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:35 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..294 36..329 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:34 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..294 36..329 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:03 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..294 36..329 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:31 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..294 36..329 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:54 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:34 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:34 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:03 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:31 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
CG10834-RA 26..443 1..418 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:42 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22106862..22107279 1..418 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:42 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22106862..22107279 1..418 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:42 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22106862..22107279 1..418 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:34 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 22106862..22107279 1..418 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:34 Download gff for IP05304.complete
Subject Subject Range Query Range Percent Splice Strand
2L 22106862..22107279 1..418 100   Minus

IP05304.hyp Sequence

Translation from 35 to 328

> IP05304.hyp
MSAEIEDLLKRYQNYPNVSGIIILDPFAIPIKTTMEYTLTVHYAALISTL
TYKAAKMITNLDASNELVTIRLRTKVHEVIVLPSENYIIIVVQNPGT*

IP05304.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:34:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-PA 97 CG10834-PA 1..97 1..97 482 100 Plus
robl22E-PB 97 CG10838-PB 1..95 1..95 282 53.7 Plus
robl22E-PA 97 CG10838-PA 1..95 1..95 282 53.7 Plus
robl-PA 97 CG10751-PA 1..95 1..95 230 44.2 Plus
CG10822-PA 114 CG10822-PA 15..104 5..94 159 31.1 Plus

IP05304.pep Sequence

Translation from 35 to 328

> IP05304.pep
MSAEIEDLLKRYQNYPNVSGIIILDPFAIPIKTTMEYTLTVHYAALISTL
TYKAAKMITNLDASNELVTIRLRTKVHEVIVLPSENYIIIVVQNPGT*

IP05304.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21526-PA 97 GF21526-PA 1..96 1..96 410 78.1 Plus
Dana\GF15283-PA 97 GF15283-PA 1..95 1..95 288 53.7 Plus
Dana\GF13122-PA 97 GF13122-PA 1..95 1..95 240 44.2 Plus
Dana\GF12509-PA 141 GF12509-PA 36..125 5..94 146 31.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21468-PA 97 GG21468-PA 1..97 1..97 483 96.9 Plus
Dere\GG24530-PA 97 GG24530-PA 1..96 1..96 287 51 Plus
Dere\GG20680-PA 100 GG20680-PA 5..98 2..95 234 43.6 Plus
Dere\GG22008-PA 114 GG22008-PA 15..104 5..94 159 31.1 Plus
Dere\GG21147-PA 115 GG21147-PA 3..95 2..94 134 29 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13788-PA 97 GH13788-PA 1..95 1..95 273 50.5 Plus
Dgri\GH21399-PA 97 GH21399-PA 1..95 1..95 240 44.2 Plus
Dgri\GH20486-PA 108 GH20486-PA 16..105 5..94 169 31.1 Plus
Dgri\GH22877-PA 116 GH22877-PA 3..104 2..94 143 31.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG10834-PA 97 CG10834-PA 1..97 1..97 482 100 Plus
robl22E-PB 97 CG10838-PB 1..95 1..95 282 53.7 Plus
robl22E-PA 97 CG10838-PA 1..95 1..95 282 53.7 Plus
robl-PA 97 CG10751-PA 1..95 1..95 230 44.2 Plus
CG10822-PA 114 CG10822-PA 15..104 5..94 159 31.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:09:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17191-PA 97 GI17191-PA 1..96 1..96 276 53.1 Plus
Dmoj\GI18578-PA 108 GI18578-PA 13..106 2..95 234 43.6 Plus
Dmoj\GI16945-PA 110 GI16945-PA 1..94 2..89 176 38.3 Plus
Dmoj\GI21029-PA 100 GI21029-PA 8..97 5..94 154 28.9 Plus
Dmoj\GI21258-PA 115 GI21258-PA 9..104 10..94 132 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26110-PA 97 GL26110-PA 1..95 1..95 350 67.4 Plus
Dper\GL19405-PA 97 GL19405-PA 1..95 1..95 273 50.5 Plus
Dper\GL11426-PA 97 GL11426-PA 1..95 1..95 240 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10585-PA 97 GA10585-PA 1..95 1..95 352 68.4 Plus
Dpse\GA10586-PA 97 GA10586-PA 1..95 1..95 273 50.5 Plus
Dpse\GA10543-PA 97 GA10543-PA 1..95 1..95 240 44.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16116-PA 97 GM16116-PA 1..97 1..97 486 97.9 Plus
Dsec\GM18239-PA 97 GM18239-PA 1..95 1..95 292 53.7 Plus
Dsec\GM21776-PA 97 GM21776-PA 1..95 1..95 240 44.2 Plus
Dsec\GM26651-PA 97 GM26651-PA 1..95 1..95 240 44.2 Plus
Dsec\GM21987-PA 114 GM21987-PA 15..104 5..94 160 31.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21619-PA 97 GD21619-PA 1..97 1..97 486 97.9 Plus
Dsim\GD22844-PA 97 GD22844-PA 1..95 1..95 292 53.7 Plus
Dsim\GD11269-PA 97 GD11269-PA 1..95 1..95 240 44.2 Plus
Dsim\GD11487-PA 111 GD11487-PA 15..104 5..94 160 31.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22281-PA 97 GJ22281-PA 1..95 1..95 262 46.3 Plus
Dvir\GJ20372-PA 97 GJ20372-PA 1..95 1..95 240 44.2 Plus
Dvir\GJ21956-PA 106 GJ21956-PA 14..103 5..94 170 32.2 Plus
Dvir\GJ21607-PA 119 GJ21607-PA 40..113 21..94 139 36.5 Plus
Dvir\GJ20860-PA 116 GJ20860-PA 3..104 2..94 138 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18698-PA 97 GK18698-PA 1..96 1..96 358 67.7 Plus
Dwil\GK14988-PA 97 GK14988-PA 1..96 1..96 289 54.2 Plus
Dwil\GK22899-PA 97 GK22899-PA 1..95 1..95 240 44.2 Plus
Dwil\GK19223-PA 113 GK19223-PA 8..97 5..94 175 37.8 Plus
Dwil\GK15784-PA 118 GK15784-PA 21..106 10..95 165 34.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:09:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12939-PA 97 GE12939-PA 1..97 1..97 480 95.9 Plus
Dyak\GE15136-PA 97 GE15136-PA 1..95 1..95 278 50.5 Plus
Dyak\GE11664-PA 97 GE11664-PA 1..95 1..95 240 44.2 Plus
Dyak\GE12086-PA 114 GE12086-PA 15..104 5..94 167 32.2 Plus
Dyak\GE14190-PA 104 GE14190-PA 8..97 5..94 136 27.8 Plus