Clone IP05345 Report

Search the DGRC for IP05345

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:53
Well:45
Vector:pOT2
Associated Gene/TranscriptCG13063-RA
Protein status:IP05345.pep: gold
Preliminary Size:390
Sequenced Size:602

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13063 2005-01-01 Successful iPCR screen
CG13063 2008-04-29 Release 5.5 accounting
CG13063 2008-08-15 Release 5.9 accounting
CG13063 2008-12-18 5.12 accounting

Clone Sequence Records

IP05345.complete Sequence

602 bp (602 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024391

> IP05345.complete
TTCGCTTCAGCAGCACAACACAGACCAAGAAACAAAAATCCTTAAACATG
TTCAAATTGGTGGTGTTGTCTGCTCTCCTCGCCGTAGCTGTCGCTCGTCC
CGGTCATCTTTATGAGTCTCCTCTGGTTTATGCCGCTCCAGCTGCCACAA
CCGTTGTCCAGGAGCGCTCTCTGGCCAAGGTGGGTTCTGTGGTCAGCAGC
ATTCCCACATCGGTCTCCCACCAGAGCCAGTCGGTGGTGCACAGCCACTC
GCATGTAGTGGAGGACATCGTGGCCCCGGTGGTGAAGTCCACTCCGGTGG
TCAGCTATGCTGCAGCTGCCCCAGTGGTGCATACCGCCTATGCTGCCGCT
CCCGTTGTCCACACCAGCTATGCCGCCCCGGTGGTGCACACCTCCTATGC
CGCCGCTTCTCCGGTTGTCTACAACTCCAGCTGGTAATCGAAAGACTAGA
CCTTTGGGGACTCATCCCAGCGAACTGGACGGTTAGAAAATAGCGATTCC
TATTGTACATAATTGAGTTTAATTGCGAGTAAAATGTGATTGTTAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

IP05345.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG13063-RA 646 CG13063-RA 54..603 1..550 2750 100 Plus
CG13043-RA 645 CG13043-RA 76..398 48..367 705 81.7 Plus
CG13044-RA 935 CG13044-RA 318..445 118..245 205 77.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16296447..16296932 59..544 2385 99.4 Plus
chr3L 24539361 chr3L 16295196..16295518 367..48 710 82 Minus
chr3L 24539361 chr3L 16296327..16296387 1..61 305 100 Plus
chr3L 24539361 chr3L 16292565..16292692 245..118 205 77.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16306720..16307211 59..550 2460 100 Plus
3L 28110227 3L 16305469..16305791 367..48 695 81.7 Minus
3L 28110227 3L 16306600..16306660 1..61 305 100 Plus
3L 28110227 3L 16302851..16302978 245..118 205 77.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16299820..16300311 59..550 2460 100 Plus
3L 28103327 3L 16298569..16298891 367..48 705 81.7 Minus
3L 28103327 3L 16299700..16299760 1..61 305 100 Plus
3L 28103327 3L 16295951..16296078 245..118 205 77.3 Minus
Blast to na_te.dros performed on 2019-03-15 22:15:01 has no hits.

IP05345.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:15:48 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16296327..16296385 1..59 100 -> Plus
chr3L 16296448..16296932 60..544 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:42 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:59 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:12:45 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:08:12 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:51 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:24 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:59 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:12:45 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..544 1..544 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:08:13 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..390 48..437 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:51 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
CG13063-RA 1..544 1..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:48 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16306600..16306658 1..59 100 -> Plus
3L 16306721..16307205 60..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:48 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16306600..16306658 1..59 100 -> Plus
3L 16306721..16307205 60..544 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:15:48 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16306600..16306658 1..59 100 -> Plus
3L 16306721..16307205 60..544 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:12:45 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16299700..16299758 1..59 100 -> Plus
arm_3L 16299821..16300305 60..544 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:17 Download gff for IP05345.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16299700..16299758 1..59 100 -> Plus
3L 16299821..16300305 60..544 100   Plus

IP05345.hyp Sequence

Translation from 2 to 436

> IP05345.hyp
RFSSTTQTKKQKSLNMFKLVVLSALLAVAVARPGHLYESPLVYAAPAATT
VVQERSLAKVGSVVSSIPTSVSHQSQSVVHSHSHVVEDIVAPVVKSTPVV
SYAAAAPVVHTAYAAAPVVHTSYAAPVVHTSYAAASPVVYNSSW*

IP05345.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13063-PA 129 CG13063-PA 1..129 16..144 635 100 Plus
CG13043-PA 148 CG13043-PA 1..130 16..142 530 85.4 Plus
CG13044-PA 155 CG13044-PA 1..146 16..142 340 56.5 Plus
CG13042-PA 117 CG13042-PA 1..102 16..117 243 50 Plus
CG13060-PA 131 CG13060-PA 1..116 16..139 190 46.9 Plus

IP05345.pep Sequence

Translation from 47 to 436

> IP05345.pep
MFKLVVLSALLAVAVARPGHLYESPLVYAAPAATTVVQERSLAKVGSVVS
SIPTSVSHQSQSVVHSHSHVVEDIVAPVVKSTPVVSYAAAAPVVHTAYAA
APVVHTSYAAPVVHTSYAAASPVVYNSSW*

IP05345.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24178-PA 138 GF24178-PA 1..138 1..129 433 71.2 Plus
Dana\GF10298-PA 145 GF10298-PA 1..121 1..127 374 76 Plus
Dana\GF10297-PA 112 GF10297-PA 1..101 1..111 221 48.7 Plus
Dana\GF10299-PA 158 GF10299-PA 1..65 1..66 218 69.7 Plus
Dana\GF24187-PA 194 GF24187-PA 110..189 25..104 138 44.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15982-PA 129 GG15982-PA 1..129 1..129 591 97.7 Plus
Dere\GG13470-PA 147 GG13470-PA 1..129 1..127 386 86.8 Plus
Dere\GG13469-PA 117 GG13469-PA 1..97 1..116 222 47.5 Plus
Dere\GG13471-PA 155 GG13471-PA 1..146 1..127 206 51 Plus
Dere\GG15991-PA 191 GG15991-PA 107..170 25..85 139 51.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15608-PA 163 GH15608-PA 1..140 1..127 396 72.9 Plus
Dgri\GH15607-PA 111 GH15607-PA 1..101 1..111 198 59.3 Plus
Dgri\GH15610-PA 166 GH15610-PA 1..113 1..123 189 62.5 Plus
Dgri\GH15877-PA 123 GH15877-PA 1..120 1..126 151 45.2 Plus
Dgri\GH15606-PA 114 GH15606-PA 1..111 1..126 144 44.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13063-PA 129 CG13063-PA 1..129 1..129 635 100 Plus
CG13043-PA 148 CG13043-PA 1..130 1..127 530 85.4 Plus
CG13044-PA 155 CG13044-PA 1..146 1..127 340 56.5 Plus
CG13042-PA 117 CG13042-PA 1..102 1..102 243 50 Plus
CG13060-PA 131 CG13060-PA 1..116 1..124 190 46.9 Plus
CG13041-PA 124 CG13041-PA 1..99 1..115 174 47.5 Plus
CG13040-PB 185 CG13040-PB 1..139 1..124 149 35.1 Plus
CG13040-PA 185 CG13040-PA 1..139 1..124 149 35.1 Plus
retinin-PA 191 CG13057-PA 107..170 25..85 149 48.4 Plus
CG18294-PA 141 CG18294-PA 1..133 1..127 137 35.8 Plus
CG13059-PA 155 CG13059-PA 1..152 1..127 136 32.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16885-PA 140 GI16885-PA 1..118 1..117 404 87.4 Plus
Dmoj\GI16886-PA 146 GI16886-PA 1..146 1..129 175 50 Plus
Dmoj\GI16883-PA 112 GI16883-PA 1..101 1..111 173 54.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17848-PA 120 GL17848-PA 1..120 1..129 388 76 Plus
Dper\GL17864-PA 120 GL17864-PA 1..120 1..129 388 75.2 Plus
Dper\GL17989-PA 120 GL17989-PA 1..120 1..129 380 74.4 Plus
Dper\GL18010-PA 142 GL18010-PA 1..121 1..124 281 74.2 Plus
Dper\GL18009-PA 110 GL18009-PA 1..99 1..111 212 49.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28359-PA 120 GA28359-PA 1..120 1..129 388 75.2 Plus
Dpse\GA28511-PA 120 GA28511-PA 1..120 1..129 385 75.2 Plus
Dpse\GA28521-PA 120 GA28521-PA 1..120 1..129 370 72.9 Plus
Dpse\GA11997-PA 142 GA11997-PA 1..121 1..124 281 74.2 Plus
Dpse\GA11996-PA 110 GA11996-PA 1..99 1..111 212 49.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25614-PA 129 GM25614-PA 1..129 1..129 589 97.7 Plus
Dsec\GM24419-PA 148 GM24419-PA 1..130 1..127 382 85.4 Plus
Dsec\GM24418-PA 117 GM24418-PA 1..97 1..116 222 47.5 Plus
Dsec\GM24420-PA 155 GM24420-PA 1..146 1..127 206 51 Plus
Dsec\GM25623-PA 191 GM25623-PA 107..170 25..85 138 51.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14619-PA 129 GD14619-PA 1..129 1..129 595 99.2 Plus
Dsim\GD12489-PA 148 GD12489-PA 1..130 1..127 374 83.8 Plus
Dsim\GD12488-PA 117 GD12488-PA 1..97 1..116 222 47.5 Plus
Dsim\GD12490-PA 155 GD12490-PA 1..146 1..127 205 51 Plus
Dsim\GD14627-PA 175 GD14627-PA 91..154 25..85 137 51.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:13:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12633-PA 170 GJ12633-PA 1..130 1..127 391 74.6 Plus
Dvir\GJ12632-PA 113 GJ12632-PA 1..102 1..111 203 56.8 Plus
Dvir\GJ12634-PA 152 GJ12634-PA 1..64 1..66 163 68.2 Plus
Dvir\GJ12785-PA 179 GJ12785-PA 95..174 25..104 142 45.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17642-PA 147 GK17642-PA 1..130 1..123 327 80.8 Plus
Dwil\GK16556-PA 131 GK16556-PA 1..131 1..129 295 73.3 Plus
Dwil\GK17641-PA 115 GK17641-PA 1..103 1..111 215 46.9 Plus
Dwil\GK17643-PA 148 GK17643-PA 1..135 1..124 166 50.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:13:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23177-PA 129 GE23177-PA 1..129 1..129 595 99.2 Plus
Dyak\GE23097-PA 129 GE23097-PA 1..129 1..129 588 98.4 Plus
Dyak\GE22900-PA 148 GE22900-PA 1..130 1..127 381 85.4 Plus
Dyak\GE22803-PA 137 GE22803-PA 1..134 1..128 359 80.6 Plus
Dyak\GE22801-PA 117 GE22801-PA 1..97 1..116 222 47.5 Plus