Clone IP05362 Report

Search the DGRC for IP05362

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:53
Well:62
Vector:pOT2
Associated Gene/TranscriptCG13454-RA
Protein status:IP05362.pep: gold
Preliminary Size:339
Sequenced Size:512

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13454 2005-01-01 Successful iPCR screen
CG13454 2008-04-29 Release 5.5 accounting
CG13454 2008-08-15 Release 5.9 accounting
CG13454 2008-12-18 5.12 accounting

Clone Sequence Records

IP05362.complete Sequence

512 bp (512 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023647

> IP05362.complete
ATGTCCTCCGATTCCACGCTGTACTTCAGTGCCGTCGAGGATATGTTCAA
GGAAGTGTTAACAATAGGGGACGAGAAGAGGGATCCTGGAAACGAGGATT
TCTCCGAAACACCTAAACGTTGCGTACGATTGCGCCAGCAAAAGTTGTTC
GCGAACGATACCGCGAGTTTTGTGATAGGTCGCCGTTCGCCGAGGATTGA
ATCCAAAATCGATCTCAACAGAGATGTATCTCCTGGAAGGCGAAAGGAGC
TGCGCGGCGAGGAAATCCTTCGGATGCGCAAGGATCGGGCGGAAAAGGAG
CGTCTGAGGCCCCAAAGGCGTCTTACCATGCGGATTTAGTGCCACACCTA
TCGATATGATAGCTATCCACCGAGTTCATTGTGTTCCCCAATCGAAGTGC
TTCCCTGTTGTATGCTCTACTTTAGGATTTATTTTTAAGCTCACCTAAGT
ATGCTAAGTTTTGAGTGCCAATAAATAAAGTTATTAGTGAATACAAAAAA
AAAAAAAAAAAA

IP05362.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13454-RA 520 CG13454-RA 27..520 1..494 2470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15506476..15506969 494..1 2395 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15516531..15517026 496..1 2480 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15509631..15510126 496..1 2480 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:16:16 has no hits.

IP05362.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:17:20 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15506476..15506969 1..494 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:43 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 1..339 1..339 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:36 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 1..339 1..339 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:13:22 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 1..339 1..339 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:04 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 1..339 1..339 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:26 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 1..339 1..339 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:56 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 27..520 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:36 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 27..520 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:13:22 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 31..524 1..494 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:04 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 27..520 1..494 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:26 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
CG13454-RA 31..524 1..494 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:20 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15516533..15517026 1..494 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:20 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15516533..15517026 1..494 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:17:20 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15516533..15517026 1..494 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:13:22 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15509633..15510126 1..494 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:35 Download gff for IP05362.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15509633..15510126 1..494 100   Minus

IP05362.pep Sequence

Translation from 0 to 338

> IP05362.pep
MSSDSTLYFSAVEDMFKEVLTIGDEKRDPGNEDFSETPKRCVRLRQQKLF
ANDTASFVIGRRSPRIESKIDLNRDVSPGRRKELRGEEILRMRKDRAEKE
RLRPQRRLTMRI*

IP05362.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10730-PA 116 GF10730-PA 3..116 2..112 337 59.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13547-PA 112 GG13547-PA 1..112 1..112 465 78.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23378-PA 118 GH23378-PA 3..118 2..112 191 41.7 Plus
Dgri\GH17021-PA 118 GH17021-PA 3..118 2..112 191 41.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13454-PA 112 CG13454-PA 1..112 1..112 565 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12226-PA 112 GI12226-PA 3..112 2..112 202 45.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25616-PA 119 GL25616-PA 1..119 1..112 294 54.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12298-PA 119 GA12298-PA 1..119 1..112 289 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24489-PA 112 GM24489-PA 1..112 1..112 535 92.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12560-PA 112 GD12560-PA 1..112 1..112 525 90.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11456-PA 116 GJ11456-PA 3..116 2..112 228 47.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18950-PA 119 GK18950-PA 1..119 1..112 209 42.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22846-PA 114 GE22846-PA 1..114 1..112 493 84.2 Plus
Dyak\GE19848-PA 114 GE19848-PA 1..114 1..112 492 84.2 Plus

IP05362.hyp Sequence

Translation from 1 to 338

> IP05362.hyp
MSSDSTLYFSAVEDMFKEVLTIGDEKRDPGNEDFSETPKRCVRLRQQKLF
ANDTASFVIGRRSPRIESKIDLNRDVSPGRRKELRGEEILRMRKDRAEKE
RLRPQRRLTMRI*

IP05362.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13454-PA 112 CG13454-PA 1..112 1..112 565 100 Plus