BDGP Sequence Production Resources |
Search the DGRC for IP05362
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 53 |
Well: | 62 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13454-RA |
Protein status: | IP05362.pep: gold |
Preliminary Size: | 339 |
Sequenced Size: | 512 |
Gene | Date | Evidence |
---|---|---|
CG13454 | 2005-01-01 | Successful iPCR screen |
CG13454 | 2008-04-29 | Release 5.5 accounting |
CG13454 | 2008-08-15 | Release 5.9 accounting |
CG13454 | 2008-12-18 | 5.12 accounting |
512 bp (512 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023647
> IP05362.complete ATGTCCTCCGATTCCACGCTGTACTTCAGTGCCGTCGAGGATATGTTCAA GGAAGTGTTAACAATAGGGGACGAGAAGAGGGATCCTGGAAACGAGGATT TCTCCGAAACACCTAAACGTTGCGTACGATTGCGCCAGCAAAAGTTGTTC GCGAACGATACCGCGAGTTTTGTGATAGGTCGCCGTTCGCCGAGGATTGA ATCCAAAATCGATCTCAACAGAGATGTATCTCCTGGAAGGCGAAAGGAGC TGCGCGGCGAGGAAATCCTTCGGATGCGCAAGGATCGGGCGGAAAAGGAG CGTCTGAGGCCCCAAAGGCGTCTTACCATGCGGATTTAGTGCCACACCTA TCGATATGATAGCTATCCACCGAGTTCATTGTGTTCCCCAATCGAAGTGC TTCCCTGTTGTATGCTCTACTTTAGGATTTATTTTTAAGCTCACCTAAGT ATGCTAAGTTTTGAGTGCCAATAAATAAAGTTATTAGTGAATACAAAAAA AAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13454-RA | 520 | CG13454-RA | 27..520 | 1..494 | 2470 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 15506476..15506969 | 494..1 | 2395 | 99 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 15516531..15517026 | 496..1 | 2480 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 15509631..15510126 | 496..1 | 2480 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 15506476..15506969 | 1..494 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 1..339 | 1..339 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 1..339 | 1..339 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 1..339 | 1..339 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 1..339 | 1..339 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 1..339 | 1..339 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 27..520 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 27..520 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 31..524 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 27..520 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13454-RA | 31..524 | 1..494 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15516533..15517026 | 1..494 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15516533..15517026 | 1..494 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15516533..15517026 | 1..494 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 15509633..15510126 | 1..494 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 15509633..15510126 | 1..494 | 100 | Minus |
Translation from 0 to 338
> IP05362.pep MSSDSTLYFSAVEDMFKEVLTIGDEKRDPGNEDFSETPKRCVRLRQQKLF ANDTASFVIGRRSPRIESKIDLNRDVSPGRRKELRGEEILRMRKDRAEKE RLRPQRRLTMRI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10730-PA | 116 | GF10730-PA | 3..116 | 2..112 | 337 | 59.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13547-PA | 112 | GG13547-PA | 1..112 | 1..112 | 465 | 78.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23378-PA | 118 | GH23378-PA | 3..118 | 2..112 | 191 | 41.7 | Plus |
Dgri\GH17021-PA | 118 | GH17021-PA | 3..118 | 2..112 | 191 | 41.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13454-PA | 112 | CG13454-PA | 1..112 | 1..112 | 565 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12226-PA | 112 | GI12226-PA | 3..112 | 2..112 | 202 | 45.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25616-PA | 119 | GL25616-PA | 1..119 | 1..112 | 294 | 54.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12298-PA | 119 | GA12298-PA | 1..119 | 1..112 | 289 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24489-PA | 112 | GM24489-PA | 1..112 | 1..112 | 535 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12560-PA | 112 | GD12560-PA | 1..112 | 1..112 | 525 | 90.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11456-PA | 116 | GJ11456-PA | 3..116 | 2..112 | 228 | 47.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18950-PA | 119 | GK18950-PA | 1..119 | 1..112 | 209 | 42.6 | Plus |
Translation from 1 to 338
> IP05362.hyp MSSDSTLYFSAVEDMFKEVLTIGDEKRDPGNEDFSETPKRCVRLRQQKLF ANDTASFVIGRRSPRIESKIDLNRDVSPGRRKELRGEEILRMRKDRAEKE RLRPQRRLTMRI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13454-PA | 112 | CG13454-PA | 1..112 | 1..112 | 565 | 100 | Plus |