BDGP Sequence Production Resources |
Search the DGRC for IP05383
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 53 |
Well: | 83 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13919-RA |
Protein status: | IP05383.pep: gold |
Preliminary Size: | 396 |
Sequenced Size: | 532 |
Gene | Date | Evidence |
---|---|---|
CG13919 | 2008-04-29 | Release 5.5 accounting |
CG13919 | 2008-08-15 | Release 5.9 accounting |
CG13919 | 2008-12-18 | 5.12 accounting |
532 bp (532 high quality bases) assembled on 2006-09-14
GenBank Submission: BT029047
> IP05383.complete TGCATTCTATTCACGGTAACTTCGCTTTGTTTATTTTCTGTAATACCATG GAAAATATATAAATAAGTGACAAAGATGACACTGGCACACCGGGCGCTCT TCACTTGGTTTATCGTCCTGGTCTTCCTGATTCTTCTGTGTCTCCGCCTG GACCCACGCACCACCTGGAATTGGTTCGTCACCTTTACGCCACTCTGGTT CTTCGATGTGATCATTATCATCTACGTGATCATTAAATTTATCCGCAAGT GGCGGAACCTAACCTGCCTGACGGATCTCCTGTTCCTCTACAAATGGAAC ATTGCCGGCGTCCTGCTGACCATCGCCTCCCAAGTGATGATCTGCCTAAC GCTGGAGTACCCGCAACAGATTCCCATATACGTGACCGTTGCCCCGGTCA TCCTGCTGCTGAGCACCGCCATCTTCTATGTTGGCAGCAGGCTGGGAAAA CGAGAGGGCTGGATACAGTAATATTAAGCATATATTGTAGGATTAGGTGT ACATAAAGTGAAAACTCAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 1645062..1645578 | 1..517 | 2525 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 1645467..1645987 | 1..521 | 2605 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 1645467..1645987 | 1..521 | 2605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 1645062..1645578 | 1..517 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..396 | 76..471 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..396 | 76..471 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..396 | 76..471 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..396 | 76..471 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..396 | 76..471 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..396 | 76..471 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..517 | 1..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..517 | 1..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..396 | 76..471 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13919-RA | 1..517 | 1..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1645467..1645983 | 1..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1645467..1645983 | 1..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1645467..1645983 | 1..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 1645467..1645983 | 1..517 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 1645467..1645983 | 1..517 | 100 | Plus |
Translation from 75 to 470
> IP05383.hyp MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIY VIIKFIRKWRNLTCLTDLLFLYKWNIAGVLLTIASQVMICLTLEYPQQIP IYVTVAPVILLLSTAIFYVGSRLGKREGWIQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13919-PA | 131 | CG13919-PA | 1..131 | 1..131 | 693 | 100 | Plus |
Translation from 75 to 470
> IP05383.pep MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIY VIIKFIRKWRNLTCLTDLLFLYKWNIAGVLLTIASQVMICLTLEYPQQIP IYVTVAPVILLLSTAIFYVGSRLGKREGWIQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24820-PA | 131 | GF24820-PA | 1..131 | 1..131 | 564 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14809-PA | 131 | GG14809-PA | 1..131 | 1..131 | 661 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15955-PA | 131 | GH15955-PA | 1..131 | 1..131 | 559 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13919-PA | 131 | CG13919-PA | 1..131 | 1..131 | 693 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16608-PA | 131 | GI16608-PA | 1..131 | 1..131 | 564 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11906-PA | 131 | GL11906-PA | 1..131 | 1..131 | 575 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12625-PA | 131 | GA12625-PA | 1..131 | 1..131 | 575 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14431-PA | 131 | GM14431-PA | 1..131 | 1..131 | 661 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13633-PA | 131 | GD13633-PA | 1..131 | 1..131 | 661 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12862-PA | 131 | GJ12862-PA | 1..131 | 1..131 | 583 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19107-PA | 131 | GK19107-PA | 1..130 | 1..130 | 552 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21172-PA | 131 | GE21172-PA | 1..131 | 1..131 | 657 | 99.2 | Plus |