Clone IP05383 Report

Search the DGRC for IP05383

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:53
Well:83
Vector:pOT2
Associated Gene/TranscriptCG13919-RA
Protein status:IP05383.pep: gold
Preliminary Size:396
Sequenced Size:532

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13919 2008-04-29 Release 5.5 accounting
CG13919 2008-08-15 Release 5.9 accounting
CG13919 2008-12-18 5.12 accounting

Clone Sequence Records

IP05383.complete Sequence

532 bp (532 high quality bases) assembled on 2006-09-14

GenBank Submission: BT029047

> IP05383.complete
TGCATTCTATTCACGGTAACTTCGCTTTGTTTATTTTCTGTAATACCATG
GAAAATATATAAATAAGTGACAAAGATGACACTGGCACACCGGGCGCTCT
TCACTTGGTTTATCGTCCTGGTCTTCCTGATTCTTCTGTGTCTCCGCCTG
GACCCACGCACCACCTGGAATTGGTTCGTCACCTTTACGCCACTCTGGTT
CTTCGATGTGATCATTATCATCTACGTGATCATTAAATTTATCCGCAAGT
GGCGGAACCTAACCTGCCTGACGGATCTCCTGTTCCTCTACAAATGGAAC
ATTGCCGGCGTCCTGCTGACCATCGCCTCCCAAGTGATGATCTGCCTAAC
GCTGGAGTACCCGCAACAGATTCCCATATACGTGACCGTTGCCCCGGTCA
TCCTGCTGCTGAGCACCGCCATCTTCTATGTTGGCAGCAGGCTGGGAAAA
CGAGAGGGCTGGATACAGTAATATTAAGCATATATTGTAGGATTAGGTGT
ACATAAAGTGAAAACTCAAAAAAAAAAAAAAA

IP05383.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:04:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13919-RA 517 CG13919-RA 1..517 1..517 2585 100 Plus
CG17249-RA 1534 CG17249-RA 1478..1534 521..465 285 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:07:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1645062..1645578 1..517 2525 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1645467..1645987 1..521 2605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1645467..1645987 1..521 2605 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:07:31 has no hits.

IP05383.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:08:28 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1645062..1645578 1..517 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:46 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..396 76..471 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:59 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..396 76..471 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:34 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..396 76..471 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:25:30 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..396 76..471 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:56:18 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..396 76..471 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:48:46 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..396 76..471 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:59 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..517 1..517 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:34 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..517 1..517 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:25:30 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..396 76..471 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:56:18 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
CG13919-RA 1..517 1..517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:28 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1645467..1645983 1..517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:28 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1645467..1645983 1..517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:28 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1645467..1645983 1..517 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:34 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1645467..1645983 1..517 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:13 Download gff for IP05383.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1645467..1645983 1..517 100   Plus

IP05383.hyp Sequence

Translation from 75 to 470

> IP05383.hyp
MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIY
VIIKFIRKWRNLTCLTDLLFLYKWNIAGVLLTIASQVMICLTLEYPQQIP
IYVTVAPVILLLSTAIFYVGSRLGKREGWIQ*

IP05383.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13919-PA 131 CG13919-PA 1..131 1..131 693 100 Plus

IP05383.pep Sequence

Translation from 75 to 470

> IP05383.pep
MTLAHRALFTWFIVLVFLILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIY
VIIKFIRKWRNLTCLTDLLFLYKWNIAGVLLTIASQVMICLTLEYPQQIP
IYVTVAPVILLLSTAIFYVGSRLGKREGWIQ*

IP05383.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24820-PA 131 GF24820-PA 1..131 1..131 564 88.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14809-PA 131 GG14809-PA 1..131 1..131 661 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15955-PA 131 GH15955-PA 1..131 1..131 559 83.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG13919-PA 131 CG13919-PA 1..131 1..131 693 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16608-PA 131 GI16608-PA 1..131 1..131 564 84.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11906-PA 131 GL11906-PA 1..131 1..131 575 91.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12625-PA 131 GA12625-PA 1..131 1..131 575 91.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14431-PA 131 GM14431-PA 1..131 1..131 661 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13633-PA 131 GD13633-PA 1..131 1..131 661 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12862-PA 131 GJ12862-PA 1..131 1..131 583 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19107-PA 131 GK19107-PA 1..130 1..130 552 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21172-PA 131 GE21172-PA 1..131 1..131 657 99.2 Plus