Clone IP05391 Report

Search the DGRC for IP05391

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:53
Well:91
Vector:pOT2
Associated Gene/TranscriptCG14104-RB
Protein status:IP05391.pep: gold
Preliminary Size:306
Sequenced Size:406

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14104 2005-01-01 Successful iPCR screen
CG14104 2008-04-29 Release 5.5 accounting
CG14104 2008-08-15 Release 5.9 accounting
CG14104 2008-12-18 5.12 accounting

Clone Sequence Records

IP05391.complete Sequence

406 bp (406 high quality bases) assembled on 2005-03-09

GenBank Submission: BT022393

> IP05391.complete
CGATATCAACCGATAGCAGTAATTCCAATCCAATTGCATTTAATTTAAAC
ATGAAAGAAAATAAGAAAAAGTCGCGCAAAACGGCCAATAAGACAAATGA
AACGTCAGAGGGTCAGAAAAAGAAGATCATTGAACTGCTGCACGAGTACA
ACGACCTAAAGGATGCCACCCAGCGCGTCCTGGAAGCCTTGGCCAACCTA
AAATGCGTACCCGTCGGATCGGTTTACGCTACATACAACCTGCCCCGCGA
CGAATAAAGTTTGTGCTTTTTAGACTGTTATATTTATGTACTTGTTGTAA
ACAACTTGTAATACAACGGAGTGCATGTAAATGCCTTCTGGCTTGGCAGT
TCCATGAGACTTCTGCTAATAAATCCACCTAAAACTAAAAAAAAAAAAAA
AAAAAA

IP05391.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-RB 386 CG14104-RB 1..386 1..386 1930 100 Plus
CG15881-RA 705 CG15881-RA 543..705 387..225 815 100 Minus
CG15881-RB 1682 CG15881-RB 1520..1682 387..225 815 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19796188..19796573 386..1 1930 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19806810..19807196 387..1 1935 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19799910..19800296 387..1 1935 100 Minus
Blast to na_te.dros performed 2019-03-15 20:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 3344..3438 135..38 104 62 Minus

IP05391.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:19:47 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19796188..19796573 1..386 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:47 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..207 51..257 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:45:38 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..207 51..257 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:05:59 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..207 51..257 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:26:35 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..207 51..257 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:39 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..207 51..257 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:54:25 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..386 1..386 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:45:38 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..386 1..386 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:05:59 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 4..389 1..386 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:26:35 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 1..386 1..386 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:39 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 4..389 1..386 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:47 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806811..19807196 1..386 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:47 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806811..19807196 1..386 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:47 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806811..19807196 1..386 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:05:59 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19799911..19800296 1..386 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:59:36 Download gff for IP05391.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19799911..19800296 1..386 100   Minus

IP05391.hyp Sequence

Translation from 2 to 256

> IP05391.hyp
ISTDSSNSNPIAFNLNMKENKKKSRKTANKTNETSEGQKKKIIELLHEYN
DLKDATQRVLEALANLKCVPVGSVYATYNLPRDE*

IP05391.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-PB 68 CG14104-PB 1..68 17..84 347 100 Plus

IP05391.pep Sequence

Translation from 2 to 256

> IP05391.pep
ISTDSSNSNPIAFNLNMKENKKKSRKTANKTNETSEGQKKKIIELLHEYN
DLKDATQRVLEALANLKCVPVGSVYATYNLPRDE*

IP05391.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10848-PA 75 GF10848-PA 1..72 17..81 182 59.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13371-PA 68 GG13371-PA 1..68 17..84 312 86.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16914-PA 69 GH16914-PA 21..66 36..81 128 54.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-PB 68 CG14104-PB 1..68 17..84 347 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16219-PA 68 GM16219-PA 1..68 17..84 321 92.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12249-PA 68 GD12249-PA 1..68 17..84 317 91.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16702-PA 63 GK16702-PA 5..63 26..84 126 45.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22464-PA 101 GE22464-PA 18..101 1..84 319 88.1 Plus