BDGP Sequence Production Resources |
Search the DGRC for IP05391
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 53 |
Well: | 91 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14104-RB |
Protein status: | IP05391.pep: gold |
Preliminary Size: | 306 |
Sequenced Size: | 406 |
Gene | Date | Evidence |
---|---|---|
CG14104 | 2005-01-01 | Successful iPCR screen |
CG14104 | 2008-04-29 | Release 5.5 accounting |
CG14104 | 2008-08-15 | Release 5.9 accounting |
CG14104 | 2008-12-18 | 5.12 accounting |
406 bp (406 high quality bases) assembled on 2005-03-09
GenBank Submission: BT022393
> IP05391.complete CGATATCAACCGATAGCAGTAATTCCAATCCAATTGCATTTAATTTAAAC ATGAAAGAAAATAAGAAAAAGTCGCGCAAAACGGCCAATAAGACAAATGA AACGTCAGAGGGTCAGAAAAAGAAGATCATTGAACTGCTGCACGAGTACA ACGACCTAAAGGATGCCACCCAGCGCGTCCTGGAAGCCTTGGCCAACCTA AAATGCGTACCCGTCGGATCGGTTTACGCTACATACAACCTGCCCCGCGA CGAATAAAGTTTGTGCTTTTTAGACTGTTATATTTATGTACTTGTTGTAA ACAACTTGTAATACAACGGAGTGCATGTAAATGCCTTCTGGCTTGGCAGT TCCATGAGACTTCTGCTAATAAATCCACCTAAAACTAAAAAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 19796188..19796573 | 386..1 | 1930 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 19806810..19807196 | 387..1 | 1935 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 19799910..19800296 | 387..1 | 1935 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmir\worf | 4174 | Dmir\worf WORF 4174bp Derived from AY144572. | 3344..3438 | 135..38 | 104 | 62 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 19796188..19796573 | 1..386 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..207 | 51..257 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..207 | 51..257 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..207 | 51..257 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..207 | 51..257 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..207 | 51..257 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..386 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..386 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 4..389 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 1..386 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14104-RB | 4..389 | 1..386 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19806811..19807196 | 1..386 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19806811..19807196 | 1..386 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19806811..19807196 | 1..386 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 19799911..19800296 | 1..386 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19799911..19800296 | 1..386 | 100 | Minus |
Translation from 2 to 256
> IP05391.hyp ISTDSSNSNPIAFNLNMKENKKKSRKTANKTNETSEGQKKKIIELLHEYN DLKDATQRVLEALANLKCVPVGSVYATYNLPRDE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14104-PB | 68 | CG14104-PB | 1..68 | 17..84 | 347 | 100 | Plus |
Translation from 2 to 256
> IP05391.pep ISTDSSNSNPIAFNLNMKENKKKSRKTANKTNETSEGQKKKIIELLHEYN DLKDATQRVLEALANLKCVPVGSVYATYNLPRDE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10848-PA | 75 | GF10848-PA | 1..72 | 17..81 | 182 | 59.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13371-PA | 68 | GG13371-PA | 1..68 | 17..84 | 312 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16914-PA | 69 | GH16914-PA | 21..66 | 36..81 | 128 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14104-PB | 68 | CG14104-PB | 1..68 | 17..84 | 347 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16219-PA | 68 | GM16219-PA | 1..68 | 17..84 | 321 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12249-PA | 68 | GD12249-PA | 1..68 | 17..84 | 317 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16702-PA | 63 | GK16702-PA | 5..63 | 26..84 | 126 | 45.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22464-PA | 101 | GE22464-PA | 18..101 | 1..84 | 319 | 88.1 | Plus |