Clone IP05433 Report

Search the DGRC for IP05433

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:54
Well:33
Vector:pOT2
Associated Gene/TranscriptCG12848-RA
Protein status:IP05433.pep: gold
Preliminary Size:363
Sequenced Size:469

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12848 2005-01-01 Successful iPCR screen
CG12848 2008-04-29 Release 5.5 accounting
CG12848 2008-08-15 Release 5.9 accounting
CG12848 2008-12-18 5.12 accounting

Clone Sequence Records

IP05433.complete Sequence

469 bp (469 high quality bases) assembled on 2006-09-12

GenBank Submission: BT029049

> IP05433.complete
CAGTTGTCCAGGAGTCGGTGGAAATTACGAGATGCGCGTACCCGGAGCCC
TGTTTGCCGCGCGCGGCCGAGCGCCTCAAAGCGAGAAGGACGTGCCCTTC
CAGGAGATTCTGCCTCTGCGGCTGAAGAACACCGTGAGCGGGAAGGCGGA
CTCCGGATCCGATGTGGCCTGTCTCCAGGAGATGGGCGTGCTGTTCGCCT
GCTTGAAAGACAACGAATTCGTGGAGAAGTACTGCCACAAGGAGATCAGC
CAGTTCCAGAACTGCTACAAGTGCTACATGGACCGTAAGTTTGAGGCGAA
GAAGACCGTGAACCAGGGAATCGTCCAACCGGGCAGCAACCTGAACTACA
AGCAACTTAACAAGTACATGCGCCGCTACCCCAATCCCGTATAGCTTTAC
ATAGTTCAAGTTGTTTAATAATACACTATTTACAATGTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

IP05433.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12848-RA 570 CG12848-RA 53..491 1..439 2195 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20648504..20648912 438..30 2015 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24762565..24762974 439..30 2050 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24763764..24764173 439..30 2050 100 Minus
2R 25260384 2R 24764232..24764262 31..1 155 100 Minus
Blast to na_te.dros performed on 2019-03-16 06:03:40 has no hits.

IP05433.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:04:28 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20648504..20648910 32..438 99 <- Minus
chr2R 20648971..20649001 1..31 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:53 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:12 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:15:33 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:08:52 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:14:47 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:51 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 20..457 1..438 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:12 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 20..457 1..438 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:15:33 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 32..469 1..438 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:52 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 1..363 32..394 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:14:47 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
CG12848-RA 32..469 1..438 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:28 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24762566..24762972 32..438 100 <- Minus
2R 24763033..24763063 1..31 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:28 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24762566..24762972 32..438 100 <- Minus
2R 24763033..24763063 1..31 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:04:28 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24762566..24762972 32..438 100 <- Minus
2R 24763033..24763063 1..31 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:15:33 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20650089..20650495 32..438 100 <- Minus
arm_2R 20650556..20650586 1..31 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:57 Download gff for IP05433.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24763783..24764189 32..438 100 <- Minus
2R 24764250..24764280 1..31 100   Minus

IP05433.hyp Sequence

Translation from 0 to 393

> IP05433.hyp
SCPGVGGNYEMRVPGALFAARGRAPQSEKDVPFQEILPLRLKNTVSGKAD
SGSDVACLQEMGVLFACLKDNEFVEKYCHKEISQFQNCYKCYMDRKFEAK
KTVNQGIVQPGSNLNYKQLNKYMRRYPNPV*

IP05433.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12848-PB 120 CG12848-PB 1..120 11..130 640 100 Plus
CG12848-PA 120 CG12848-PA 1..120 11..130 640 100 Plus

IP05433.pep Sequence

Translation from 31 to 393

> IP05433.pep
MRVPGALFAARGRAPQSEKDVPFQEILPLRLKNTVSGKADSGSDVACLQE
MGVLFACLKDNEFVEKYCHKEISQFQNCYKCYMDRKFEAKKTVNQGIVQP
GSNLNYKQLNKYMRRYPNPV*

IP05433.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13294-PA 120 GF13294-PA 1..120 1..120 599 93.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19897-PA 120 GG19897-PA 1..120 1..120 627 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21543-PA 120 GH21543-PA 1..119 1..119 590 91.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12848-PB 120 CG12848-PB 1..120 1..120 640 100 Plus
CG12848-PA 120 CG12848-PA 1..120 1..120 640 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19516-PA 120 GI19516-PA 1..119 1..119 602 93.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17703-PA 120 GL17703-PA 1..120 1..120 613 92.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11853-PA 120 GA11853-PA 1..120 1..120 613 92.5 Plus
Dpse\GA22470-PA 181 GA22470-PA 1..119 1..119 593 89.9 Plus
Dpse\GA22469-PA 186 GA22469-PA 1..119 1..119 593 89.9 Plus
Dpse\GA22477-PA 186 GA22477-PA 1..119 1..119 592 89.9 Plus
Dpse\GA22472-PA 186 GA22472-PA 1..119 1..119 592 89.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:51:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11797-PA 120 GM11797-PA 1..120 1..120 632 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24923-PA 131 GD24923-PA 15..131 4..120 578 94 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21085-PA 120 GJ21085-PA 1..119 1..119 588 91.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21655-PA 120 GK21655-PA 1..119 1..119 593 92.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11421-PA 120 GE11421-PA 1..120 1..120 633 98.3 Plus