BDGP Sequence Production Resources |
Search the DGRC for IP05433
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 54 |
Well: | 33 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12848-RA |
Protein status: | IP05433.pep: gold |
Preliminary Size: | 363 |
Sequenced Size: | 469 |
Gene | Date | Evidence |
---|---|---|
CG12848 | 2005-01-01 | Successful iPCR screen |
CG12848 | 2008-04-29 | Release 5.5 accounting |
CG12848 | 2008-08-15 | Release 5.9 accounting |
CG12848 | 2008-12-18 | 5.12 accounting |
469 bp (469 high quality bases) assembled on 2006-09-12
GenBank Submission: BT029049
> IP05433.complete CAGTTGTCCAGGAGTCGGTGGAAATTACGAGATGCGCGTACCCGGAGCCC TGTTTGCCGCGCGCGGCCGAGCGCCTCAAAGCGAGAAGGACGTGCCCTTC CAGGAGATTCTGCCTCTGCGGCTGAAGAACACCGTGAGCGGGAAGGCGGA CTCCGGATCCGATGTGGCCTGTCTCCAGGAGATGGGCGTGCTGTTCGCCT GCTTGAAAGACAACGAATTCGTGGAGAAGTACTGCCACAAGGAGATCAGC CAGTTCCAGAACTGCTACAAGTGCTACATGGACCGTAAGTTTGAGGCGAA GAAGACCGTGAACCAGGGAATCGTCCAACCGGGCAGCAACCTGAACTACA AGCAACTTAACAAGTACATGCGCCGCTACCCCAATCCCGTATAGCTTTAC ATAGTTCAAGTTGTTTAATAATACACTATTTACAATGTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12848-RA | 570 | CG12848-RA | 53..491 | 1..439 | 2195 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 20648504..20648912 | 438..30 | 2015 | 99.5 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 24762565..24762974 | 439..30 | 2050 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 20648504..20648910 | 32..438 | 99 | <- | Minus |
chr2R | 20648971..20649001 | 1..31 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 1..363 | 32..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 1..363 | 32..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 1..363 | 32..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 1..363 | 32..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 1..363 | 32..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 20..457 | 1..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 20..457 | 1..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 32..469 | 1..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 1..363 | 32..394 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12848-RA | 32..469 | 1..438 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24762566..24762972 | 32..438 | 100 | <- | Minus |
2R | 24763033..24763063 | 1..31 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24762566..24762972 | 32..438 | 100 | <- | Minus |
2R | 24763033..24763063 | 1..31 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24762566..24762972 | 32..438 | 100 | <- | Minus |
2R | 24763033..24763063 | 1..31 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 20650089..20650495 | 32..438 | 100 | <- | Minus |
arm_2R | 20650556..20650586 | 1..31 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24763783..24764189 | 32..438 | 100 | <- | Minus |
2R | 24764250..24764280 | 1..31 | 100 | Minus |
Translation from 0 to 393
> IP05433.hyp SCPGVGGNYEMRVPGALFAARGRAPQSEKDVPFQEILPLRLKNTVSGKAD SGSDVACLQEMGVLFACLKDNEFVEKYCHKEISQFQNCYKCYMDRKFEAK KTVNQGIVQPGSNLNYKQLNKYMRRYPNPV*
Translation from 31 to 393
> IP05433.pep MRVPGALFAARGRAPQSEKDVPFQEILPLRLKNTVSGKADSGSDVACLQE MGVLFACLKDNEFVEKYCHKEISQFQNCYKCYMDRKFEAKKTVNQGIVQP GSNLNYKQLNKYMRRYPNPV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13294-PA | 120 | GF13294-PA | 1..120 | 1..120 | 599 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19897-PA | 120 | GG19897-PA | 1..120 | 1..120 | 627 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21543-PA | 120 | GH21543-PA | 1..119 | 1..119 | 590 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12848-PB | 120 | CG12848-PB | 1..120 | 1..120 | 640 | 100 | Plus |
CG12848-PA | 120 | CG12848-PA | 1..120 | 1..120 | 640 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19516-PA | 120 | GI19516-PA | 1..119 | 1..119 | 602 | 93.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17703-PA | 120 | GL17703-PA | 1..120 | 1..120 | 613 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11853-PA | 120 | GA11853-PA | 1..120 | 1..120 | 613 | 92.5 | Plus |
Dpse\GA22470-PA | 181 | GA22470-PA | 1..119 | 1..119 | 593 | 89.9 | Plus |
Dpse\GA22469-PA | 186 | GA22469-PA | 1..119 | 1..119 | 593 | 89.9 | Plus |
Dpse\GA22477-PA | 186 | GA22477-PA | 1..119 | 1..119 | 592 | 89.9 | Plus |
Dpse\GA22472-PA | 186 | GA22472-PA | 1..119 | 1..119 | 592 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11797-PA | 120 | GM11797-PA | 1..120 | 1..120 | 632 | 98.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24923-PA | 131 | GD24923-PA | 15..131 | 4..120 | 578 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21085-PA | 120 | GJ21085-PA | 1..119 | 1..119 | 588 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21655-PA | 120 | GK21655-PA | 1..119 | 1..119 | 593 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11421-PA | 120 | GE11421-PA | 1..120 | 1..120 | 633 | 98.3 | Plus |