IP05440.complete Sequence
601 bp (601 high quality bases) assembled on 2006-06-12
GenBank Submission: BT028779
> IP05440.complete
TCGAGTGGCCCAGGTTACTTACCCTCATCATGAAGAGCCTTTTTGCTACC
ATGTTGGGCTACTTGCTCCTTGGGTTGGTGCTGTCTCATGCCAGCTTTGC
AACTGCCACAAATGGAGTTATTCCAGCAGTGATTCCGGCAGTGCCCGCTA
CTGTTCCTCGCCTGGTTCCCGTGGCCACCAGCCATCAGTTTGTCACTCGA
AACTGGAATCGAGTTTTCGTGCCCCCCGCCACGGTGGCCACTTATCCCAA
CACCTATGTTAAGTACAGCGGTGGCTATCCGGCGTATCCCGCCTACAATT
ACCCATACGCCACCACCTATCCGTACACCTATCCCTACTACTATCCCACT
TATAACGTTGGATATGGTTACAAGGGTGTCTGGTGATCTGCAACGGACAT
AGCCTACCTTTAATACATTGTGATAACACTCGATACCAAATGATATTATA
TTATGATATATATGACAAATTTAATCAAAAACTTATTTCATATTAGATTC
ATACAACAAATTGTATAAAATATATATATATATATATAGAGAGACAATCT
CGATATTATAAATAAATGTTTCTTTGTCCATTTAAAAAAAAAAAAAAAAA
A
IP05440.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:05:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13026.a | 698 | CG13026.a | 116..698 | 1..583 | 2915 | 100 | Plus |
CG13026-RB | 698 | CG13026-RB | 116..698 | 1..583 | 2915 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:42:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 16715223..16715767 | 583..39 | 2725 | 100 | Minus |
chr3L | 24539361 | chr3L | 16715829..16715866 | 38..1 | 190 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:42:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16725509..16726054 | 584..39 | 2730 | 100 | Minus |
3L | 28110227 | 3L | 16726116..16726153 | 38..1 | 190 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 16718609..16719154 | 584..39 | 2730 | 100 | Minus |
3L | 28103327 | 3L | 16719216..16719253 | 38..1 | 190 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 14:42:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 101..212 | 439..547 | 130 | 58.9 | Plus |
Dvir\Uvir | 6564 | Dvir\Uvir VIRUVIR 6564bp | 100..211 | 439..547 | 121 | 58 | Plus |
Dvir\Het-A | 6610 | Dvir\Het-A HETAVIR 6610bp | 6503..6610 | 439..542 | 116 | 60.6 | Plus |
P-element | 2907 | P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). | 1940..2072 | 452..582 | 110 | 56.7 | Plus |
IP05440.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:43:51 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 16715223..16715767 | 39..583 | 100 | <- | Minus |
chr3L | 16715829..16715866 | 1..38 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:55 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 1..357 | 30..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:09 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 1..357 | 30..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:46:06 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 1..357 | 30..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:08:40 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 1..357 | 30..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:31:43 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 1..357 | 30..386 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:48 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 17..599 | 1..583 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:09 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 17..599 | 1..583 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:46:06 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 17..599 | 1..583 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:41 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 17..599 | 1..583 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:43 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13026-RB | 17..599 | 1..583 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:51 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16725510..16726054 | 39..583 | 100 | <- | Minus |
3L | 16726116..16726153 | 1..38 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:51 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16725510..16726054 | 39..583 | 100 | <- | Minus |
3L | 16726116..16726153 | 1..38 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:51 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16725510..16726054 | 39..583 | 100 | <- | Minus |
3L | 16726116..16726153 | 1..38 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:46:06 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16718610..16719154 | 39..583 | 100 | <- | Minus |
arm_3L | 16719216..16719253 | 1..38 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:55 Download gff for
IP05440.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16718610..16719154 | 39..583 | 100 | <- | Minus |
3L | 16719216..16719253 | 1..38 | 100 | | Minus |
IP05440.hyp Sequence
Translation from 2 to 385
> IP05440.hyp
EWPRLLTLIMKSLFATMLGYLLLGLVLSHASFATATNGVIPAVIPAVPAT
VPRLVPVATSHQFVTRNWNRVFVPPATVATYPNTYVKYSGGYPAYPAYNY
PYATTYPYTYPYYYPTYNVGYGYKGVW*
IP05440.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13026-PC | 118 | CG13026-PC | 1..118 | 10..127 | 648 | 100 | Plus |
CG13026-PB | 118 | CG13026-PB | 1..118 | 10..127 | 648 | 100 | Plus |
IP05440.pep Sequence
Translation from 2 to 385
> IP05440.pep
EWPRLLTLIMKSLFATMLGYLLLGLVLSHASFATATNGVIPAVIPAVPAT
VPRLVPVATSHQFVTRNWNRVFVPPATVATYPNTYVKYSGGYPAYPAYNY
PYATTYPYTYPYYYPTYNVGYGYKGVW*
IP05440.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:50:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10507-PA | 117 | GF10507-PA | 1..117 | 10..127 | 248 | 58.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:50:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15855-PA | 121 | GG15855-PA | 1..121 | 10..127 | 326 | 80.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13026-PC | 118 | CG13026-PC | 1..118 | 10..127 | 648 | 100 | Plus |
CG13026-PB | 118 | CG13026-PB | 1..118 | 10..127 | 648 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:50:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI11936-PA | 112 | GI11936-PA | 16..83 | 26..95 | 138 | 50 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:50:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA28585-PA | 125 | GA28585-PA | 1..97 | 10..107 | 195 | 54.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:50:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24371-PA | 138 | GM24371-PA | 8..138 | 1..127 | 453 | 90.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:50:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12446-PA | 134 | GD12446-PA | 8..134 | 1..127 | 466 | 94.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:50:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22194-PA | 135 | GE22194-PA | 14..135 | 4..127 | 357 | 83.1 | Plus |