Clone IP05440 Report

Search the DGRC for IP05440

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:54
Well:40
Vector:pOT2
Associated Gene/TranscriptCG13026-RB
Protein status:IP05440.pep: gold
Preliminary Size:405
Sequenced Size:601

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13026 2005-01-01 Successful iPCR screen
CG13026 2008-04-29 Release 5.5 accounting
CG13026 2008-08-15 Release 5.9 accounting
CG13026 2008-12-18 5.12 accounting

Clone Sequence Records

IP05440.complete Sequence

601 bp (601 high quality bases) assembled on 2006-06-12

GenBank Submission: BT028779

> IP05440.complete
TCGAGTGGCCCAGGTTACTTACCCTCATCATGAAGAGCCTTTTTGCTACC
ATGTTGGGCTACTTGCTCCTTGGGTTGGTGCTGTCTCATGCCAGCTTTGC
AACTGCCACAAATGGAGTTATTCCAGCAGTGATTCCGGCAGTGCCCGCTA
CTGTTCCTCGCCTGGTTCCCGTGGCCACCAGCCATCAGTTTGTCACTCGA
AACTGGAATCGAGTTTTCGTGCCCCCCGCCACGGTGGCCACTTATCCCAA
CACCTATGTTAAGTACAGCGGTGGCTATCCGGCGTATCCCGCCTACAATT
ACCCATACGCCACCACCTATCCGTACACCTATCCCTACTACTATCCCACT
TATAACGTTGGATATGGTTACAAGGGTGTCTGGTGATCTGCAACGGACAT
AGCCTACCTTTAATACATTGTGATAACACTCGATACCAAATGATATTATA
TTATGATATATATGACAAATTTAATCAAAAACTTATTTCATATTAGATTC
ATACAACAAATTGTATAAAATATATATATATATATATAGAGAGACAATCT
CGATATTATAAATAAATGTTTCTTTGTCCATTTAAAAAAAAAAAAAAAAA
A

IP05440.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13026.a 698 CG13026.a 116..698 1..583 2915 100 Plus
CG13026-RB 698 CG13026-RB 116..698 1..583 2915 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:42:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16715223..16715767 583..39 2725 100 Minus
chr3L 24539361 chr3L 16715829..16715866 38..1 190 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16725509..16726054 584..39 2730 100 Minus
3L 28110227 3L 16726116..16726153 38..1 190 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16718609..16719154 584..39 2730 100 Minus
3L 28103327 3L 16719216..16719253 38..1 190 100 Minus
Blast to na_te.dros performed 2019-03-16 14:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 101..212 439..547 130 58.9 Plus
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 100..211 439..547 121 58 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 6503..6610 439..542 116 60.6 Plus
P-element 2907 P-element PPI251 2907bp AKA(V01520,X69493) Derived from X06779 (g58305) (Rel. 49, Last updated, Version 8). 1940..2072 452..582 110 56.7 Plus

IP05440.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:43:51 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16715223..16715767 39..583 100 <- Minus
chr3L 16715829..16715866 1..38 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:55 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 1..357 30..386 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:05:09 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 1..357 30..386 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:46:06 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 1..357 30..386 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:08:40 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 1..357 30..386 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:31:43 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 1..357 30..386 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:30:48 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 17..599 1..583 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:05:09 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 17..599 1..583 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:46:06 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 17..599 1..583 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:08:41 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 17..599 1..583 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:43 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
CG13026-RB 17..599 1..583 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:51 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16725510..16726054 39..583 100 <- Minus
3L 16726116..16726153 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:51 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16725510..16726054 39..583 100 <- Minus
3L 16726116..16726153 1..38 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:43:51 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16725510..16726054 39..583 100 <- Minus
3L 16726116..16726153 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:46:06 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16718610..16719154 39..583 100 <- Minus
arm_3L 16719216..16719253 1..38 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:38:55 Download gff for IP05440.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16718610..16719154 39..583 100 <- Minus
3L 16719216..16719253 1..38 100   Minus

IP05440.hyp Sequence

Translation from 2 to 385

> IP05440.hyp
EWPRLLTLIMKSLFATMLGYLLLGLVLSHASFATATNGVIPAVIPAVPAT
VPRLVPVATSHQFVTRNWNRVFVPPATVATYPNTYVKYSGGYPAYPAYNY
PYATTYPYTYPYYYPTYNVGYGYKGVW*

IP05440.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13026-PC 118 CG13026-PC 1..118 10..127 648 100 Plus
CG13026-PB 118 CG13026-PB 1..118 10..127 648 100 Plus

IP05440.pep Sequence

Translation from 2 to 385

> IP05440.pep
EWPRLLTLIMKSLFATMLGYLLLGLVLSHASFATATNGVIPAVIPAVPAT
VPRLVPVATSHQFVTRNWNRVFVPPATVATYPNTYVKYSGGYPAYPAYNY
PYATTYPYTYPYYYPTYNVGYGYKGVW*

IP05440.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10507-PA 117 GF10507-PA 1..117 10..127 248 58.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15855-PA 121 GG15855-PA 1..121 10..127 326 80.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13026-PC 118 CG13026-PC 1..118 10..127 648 100 Plus
CG13026-PB 118 CG13026-PB 1..118 10..127 648 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11936-PA 112 GI11936-PA 16..83 26..95 138 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28585-PA 125 GA28585-PA 1..97 10..107 195 54.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24371-PA 138 GM24371-PA 8..138 1..127 453 90.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12446-PA 134 GD12446-PA 8..134 1..127 466 94.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22194-PA 135 GE22194-PA 14..135 4..127 357 83.1 Plus