Clone IP05441 Report

Search the DGRC for IP05441

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:54
Well:41
Vector:pOT2
Associated Gene/TranscriptCG31937-RA
Protein status:IP05441.pep: gold
Preliminary Size:369
Sequenced Size:1142

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13031 2005-01-01 Successful iPCR screen
CG31937 2008-04-29 Release 5.5 accounting
CG31937 2008-08-15 Release 5.9 accounting
CG31937 2008-12-18 5.12 accounting

Clone Sequence Records

IP05441.complete Sequence

1142 bp (1142 high quality bases) assembled on 2006-07-25

GenBank Submission: BT028780

> IP05441.complete
TTTCTCCGACCCAGCCGTGCCATACAGAGCCAACGAGATGAGCTTCCTGG
AGTTTCTGCTGCTCCTGCTCGTGCTGTACTATGTCGTGTACGTGCTCCTC
TGGATCCTGCTCGACTGCAATGTGGCCCTGTGGTACAAGTCCCGTTTCGG
AGTCTCGCTGTCGTCGATGCGCGGACAGGTGGTTTGGATAACTGGTGCCT
CGAGCGGAATTGGCCGCGCTTTGGCGCTCAGCTTGGCCAGGCATGGAGTG
AAATTGGTGCTAAGTGCCCGGCGACTGGAGCAATTGGAGCAAGTGCAAGA
GGAATGCCTAGCTGCAGCTCGCGGACTGCTGGCCACCAAGGACGTGCTGG
TCATTCAAATGGACATGCTCGATCTCGACGAGCATAAGACGCATCTCAAC
ACGGTGCTCAATCACTTTCATCGACTGGATGTCCTTGTCAATAATGCTGG
CCGATCCCAGCGAGCCAGTTGGACCGAAGTCGAGATCGAGGTGGACCGGG
AGCTGTTCGAACTGGATGTCTTTGCGGTGGTCCACCTCAGCCGCCTGGTG
GTGCGCTATTTCGTGGAGCAGAACGGCGGTAGAGGACACATCGCTGCCAC
CTCCAGCATCGCCGGCTTCAGTCCAGTGCCATTTTCACCCACCTACTGTG
CCGCCAAGCACGCCCTTAACGCCTACTTGCTCTCCCTGAAAGTGGAGATG
CGCAAGCTGGATGTGTCGCTCTTCGCACCGGGACCCATAGCCACCGATTT
CCTGCAGGAGGCCTTCACTGGCTCGCAGGGCGGAAAGGTGGGTCTGAGTA
CGGCCAATCAGAAACGGATGACGGCCCAGAGATGTGGCGATCTGTTCGCC
GTTGCCTTGGCCAATAAGATGGATCTCACCTGGTGCGGCCTCTTTCCCGT
CAACCTCTTGGCCTACTGCGCCCGGAATCCCACGCTGAGCAAGATTCTGG
CTCAATTGATGACCGAGAAGACGCTGAACAAGATTCGCGAGGGCAAACTG
TGAGAACAACCCCGGTGTGCCTCGCCCCTTCCCTATTCCTGCTCCAAACG
GCTCTCAGTCATCTTTTATACTGTTGTATAATTCTTAACTATATACTAAA
ATATATAAATATGTGCACAAGATTAAAAAAAAAAAAAAAAAA

IP05441.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:13:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG31937-RA 1125 CG31937-RA 2..1125 1..1124 5620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1729766..1730889 1..1124 5560 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1729947..1731072 1..1126 5630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1729947..1731072 1..1126 5630 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:45:21 has no hits.

IP05441.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:33 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1729766..1730889 1..1124 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:57 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 1..966 38..1003 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:21:25 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 1..966 38..1003 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:38:51 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 1..966 38..1003 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:39:45 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 1..966 38..1003 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:39 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 1..966 38..1003 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:49:58 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 2..1125 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:21:25 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 2..1125 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:38:51 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 61..1184 1..1124 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:39:45 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 2..1125 1..1124 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:39 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
CG31937-RA 61..1184 1..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:33 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1729947..1731070 1..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:33 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1729947..1731070 1..1124 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:33 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1729947..1731070 1..1124 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:38:51 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1729947..1731070 1..1124 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:50:09 Download gff for IP05441.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1729947..1731070 1..1124 100   Plus

IP05441.hyp Sequence

Translation from 0 to 1002

> IP05441.hyp
FSDPAVPYRANEMSFLEFLLLLLVLYYVVYVLLWILLDCNVALWYKSRFG
VSLSSMRGQVVWITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQE
ECLAAARGLLATKDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAG
RSQRASWTEVEIEVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAAT
SSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEMRKLDVSLFAPGPIATDF
LQEAFTGSQGGKVGLSTANQKRMTAQRCGDLFAVALANKMDLTWCGLFPV
NLLAYCARNPTLSKILAQLMTEKTLNKIREGKL*

IP05441.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31937-PA 321 CG31937-PA 1..321 13..333 1626 100 Plus
CG7601-PA 326 CG7601-PA 17..263 24..268 302 33.1 Plus
CG40485-PB 247 CG40485-PB 8..210 60..257 221 29.7 Plus
CG40485-PA 231 CG40485-PA 8..183 60..234 206 30.8 Plus
rdhB-PB 248 CG7077-PB 8..202 57..251 203 30 Plus

IP05441.pep Sequence

Translation from 37 to 1002

> IP05441.pep
MSFLEFLLLLLVLYYVVYVLLWILLDCNVALWYKSRFGVSLSSMRGQVVW
ITGASSGIGRALALSLARHGVKLVLSARRLEQLEQVQEECLAAARGLLAT
KDVLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGRSQRASWTEVEI
EVDRELFELDVFAVVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFS
PTYCAAKHALNAYLLSLKVEMRKLDVSLFAPGPIATDFLQEAFTGSQGGK
VGLSTANQKRMTAQRCGDLFAVALANKMDLTWCGLFPVNLLAYCARNPTL
SKILAQLMTEKTLNKIREGKL*

IP05441.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14007-PA 321 GF14007-PA 22..321 22..321 1432 87.3 Plus
Dana\GF22868-PA 326 GF22868-PA 17..273 12..268 305 31.5 Plus
Dana\GF22156-PA 248 GF22156-PA 7..209 47..243 210 28.8 Plus
Dana\GF18078-PA 247 GF18078-PA 7..201 45..239 198 29.6 Plus
Dana\GF18656-PA 256 GF18656-PA 5..191 46..238 197 29.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24805-PA 321 GG24805-PA 1..321 1..321 1659 97.5 Plus
Dere\GG12006-PA 326 GG12006-PA 17..264 12..257 306 32.5 Plus
Dere\GG12965-PA 257 GG12965-PA 1..192 41..238 200 30 Plus
Dere\GG10914-PA 256 GG10914-PA 5..191 46..238 200 28.7 Plus
Dere\GG17505-PA 247 GG17505-PA 8..204 48..239 199 30.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25201-PA 321 GH25201-PA 18..321 18..321 1363 81.9 Plus
Dgri\GH13989-PA 326 GH13989-PA 49..264 42..257 289 32.7 Plus
Dgri\GH17517-PA 257 GH17517-PA 5..132 46..177 200 37.9 Plus
Dgri\GH12862-PA 247 GH12862-PA 11..208 51..243 196 28.6 Plus
Dgri\GH12229-PA 250 GH12229-PA 5..213 45..248 194 26.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG31937-PA 321 CG31937-PA 1..321 1..321 1626 100 Plus
CG7601-PA 326 CG7601-PA 17..263 12..256 302 33.1 Plus
CG40485-PC 247 CG40485-PC 8..210 48..245 221 29.7 Plus
CG40485-PB 247 CG40485-PB 8..210 48..245 221 29.7 Plus
CG40485-PA 231 CG40485-PA 8..183 48..222 206 30.8 Plus
rdhB-PB 248 CG7077-PB 8..202 45..239 203 30 Plus
rdhB-PA 248 CG7077-PA 8..202 45..239 203 30 Plus
CG3699-PA 251 CG3699-PA 2..242 43..289 191 27.4 Plus
CG31549-PB 257 CG31549-PB 1..191 41..237 191 30.2 Plus
CG31549-PA 257 CG31549-PA 1..191 41..237 191 30.2 Plus
CG31548-PA 256 CG31548-PA 5..190 46..237 189 29.4 Plus
CG40486-PC 247 CG40486-PC 7..208 47..243 173 27.9 Plus
CG40486-PB 247 CG40486-PB 7..208 47..243 173 27.9 Plus
antdh-PA 250 CG1386-PA 5..207 45..242 170 25.4 Plus
CG12171-PA 257 CG12171-PA 1..191 41..237 167 26.6 Plus
spidey-PA 321 CG1444-PA 46..242 39..237 166 31.9 Plus
CG17121-PA 361 CG17121-PA 55..264 1..225 164 26.8 Plus
CG15629-PA 325 CG15629-PA 19..244 5..236 154 26.4 Plus
CG9150-PB 251 CG9150-PB 11..206 51..241 149 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22332-PA 326 GI22332-PA 17..264 12..257 291 31.3 Plus
Dmoj\GI10473-PA 247 GI10473-PA 7..202 45..240 197 30.9 Plus
Dmoj\GI14997-PA 255 GI14997-PA 2..246 43..289 197 28 Plus
Dmoj\GI14955-PA 247 GI14955-PA 5..208 45..243 186 27.1 Plus
Dmoj\GI22521-PA 256 GI22521-PA 5..191 46..238 185 28.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19653-PA 321 GL19653-PA 12..321 12..321 1466 86.8 Plus
Dper\GL13577-PA 326 GL13577-PA 17..286 12..280 292 31.2 Plus
Dper\GL14417-PA 255 GL14417-PA 2..246 43..289 208 27.4 Plus
Dper\GL23021-PA 256 GL23021-PA 5..191 46..238 205 31.3 Plus
Dper\GL24329-PA 247 GL24329-PA 7..201 45..239 191 30 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16579-PA 321 GA16579-PA 12..321 12..321 1466 86.8 Plus
Dpse\GA20472-PA 326 GA20472-PA 17..286 12..280 292 31.2 Plus
Dpse\GA17622-PA 255 GA17622-PA 2..246 43..289 208 27.4 Plus
Dpse\GA16317-PA 256 GA16317-PA 5..191 46..238 204 31.3 Plus
Dpse\GA20084-PA 247 GA20084-PA 7..201 45..239 200 30.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16831-PA 321 GM16831-PA 1..321 1..321 1681 98.8 Plus
Dsec\GM12226-PA 326 GM12226-PA 36..264 29..257 286 31.8 Plus
Dsec\GM26414-PA 248 GM26414-PA 8..202 45..239 202 30 Plus
Dsec\GM19006-PA 251 GM19006-PA 2..242 43..289 197 29 Plus
Dsec\GM10606-PA 256 GM10606-PA 5..191 46..238 197 28.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23108-PA 321 GD23108-PA 1..321 1..321 1692 99.7 Plus
Dsim\GD17678-PA 326 GD17678-PA 17..264 12..257 298 32.1 Plus
Dsim\GD23342-PA 247 GD23342-PA 8..204 48..239 218 31.7 Plus
Dsim\GD20935-PA 248 GD20935-PA 8..202 45..239 201 30 Plus
Dsim\GD16445-PA 251 GD16445-PA 2..242 43..289 197 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22769-PA 321 GJ22769-PA 1..321 1..321 1482 87.2 Plus
Dvir\GJ10521-PA 326 GJ10521-PA 17..275 12..270 310 33.2 Plus
Dvir\GJ18923-PA 247 GJ18923-PA 11..208 51..243 203 29.4 Plus
Dvir\GJ10124-PA 255 GJ10124-PA 5..190 46..238 202 30.8 Plus
Dvir\GJ23155-PA 247 GJ23155-PA 7..202 45..240 199 30.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18350-PA 321 GK18350-PA 22..321 22..321 1433 86.7 Plus
Dwil\GK20197-PA 321 GK20197-PA 22..321 22..321 1429 86.3 Plus
Dwil\GK11168-PA 326 GK11168-PA 17..263 12..256 270 32.3 Plus
Dwil\GK10169-PA 255 GK10169-PA 2..246 43..289 222 29.2 Plus
Dwil\GK14250-PA 247 GK14250-PA 7..202 45..240 200 29.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17703-PA 321 GE17703-PA 1..321 1..321 1671 98.4 Plus
Dyak\GE10432-PA 326 GE10432-PA 17..264 12..257 297 32.1 Plus
Dyak\GE15259-PA 247 GE15259-PA 8..204 48..239 219 31.2 Plus
Dyak\GE10146-PA 257 GE10146-PA 1..192 41..238 205 30.5 Plus
Dyak\GE24152-PA 256 GE24152-PA 5..191 46..238 202 29.2 Plus