Clone IP05453 Report

Search the DGRC for IP05453

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:54
Well:53
Vector:pOT2
Associated Gene/TranscriptCG13215-RA
Protein status:IP05453.pep: gold
Preliminary Size:351
Sequenced Size:637

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13215 2005-01-01 Successful iPCR screen
CG13215 2008-04-29 Release 5.5 accounting
CG13215 2008-08-15 Release 5.9 accounting
CG13215 2008-12-18 5.12 accounting

Clone Sequence Records

IP05453.complete Sequence

637 bp (637 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024392

> IP05453.complete
AACTCCAGCACCAGTGGACAAACCAAGCCAAGCTTAACTCCAAACTACAA
ATCAAAAGCCAACCATCCGCGAAATATATTCAAATATCCGATAAACATGA
AGTGCATCATATCCATCGTTGTGATCTCCATGATCTTCGGTTTAAGCCTG
ATCCAAGCAGCACCCATCGCTAAGGATGCCCAGAATCCAGGATTCGTTTC
GGCCACGGATATTACCGGAGAGCCAGTGCGCCAGAAGCGATCCAGTGCGG
ATTACTACCAGGGCGACTATTTCATCTGCTATCCCAAGAGCGCAGTGTAC
GGCAAACATGGATACGGTGCAACCAATCGCAGATCCTACGACTCGGAAGA
CTATGCGCCCCACTATTTGGCCGACGATCCATTGGTCGTTCGCCAGGCTC
GTGCTGATGCCAGACGCGCCGCCTACACCGACAGCTTTGGCAAATAAATC
AGGAACTGCCATTTAGTCACTTACTCTATGGATACCAAAATATCCCATCC
CCAAAGTTGGGAAACAGAACAGGTCTAGCTAGTAAAGATGTACAAATATT
ATTAATATTATTTATTCAACACAAATAAAATAATCAGTAAAAGAATAAAA
TAAACTGCAATATATTTAATGAAAAAAAAAAAAAAAA

IP05453.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-RA 621 CG13215-RA 1..621 1..621 3105 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7126960..7127580 621..1 2985 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11239489..11240114 626..1 3130 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11240688..11241313 626..1 3130 100 Minus
Blast to na_te.dros performed 2019-03-16 03:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 8344..8425 541..621 119 62.2 Plus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 750..796 568..614 118 72.3 Plus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6783..6873 529..620 115 59.8 Plus
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 495..564 534..602 113 64.3 Plus

IP05453.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:52:16 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7126960..7127580 1..621 95   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:26:58 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 97..447 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:29 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 97..447 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:47 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 97..447 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:25 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 97..447 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:16:50 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 97..447 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:39 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 97..447 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:29 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..621 1..621 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:47 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..621 1..621 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:25 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..351 97..447 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:16:50 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
CG13215-RA 1..621 1..621 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:16 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11239494..11240114 1..621 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:16 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11239494..11240114 1..621 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:52:16 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11239494..11240114 1..621 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:47 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7126999..7127619 1..621 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:44 Download gff for IP05453.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11240693..11241313 1..621 100   Minus

IP05453.hyp Sequence

Translation from 0 to 446

> IP05453.hyp
NSSTSGQTKPSLTPNYKSKANHPRNIFKYPINMKCIISIVVISMIFGLSL
IQAAPIAKDAQNPGFVSATDITGEPVRQKRSSADYYQGDYFICYPKSAVY
GKHGYGATNRRSYDSEDYAPHYLADDPLVVRQARADARRAAYTDSFGK*

IP05453.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-PA 116 CG13215-PA 1..116 33..148 605 100 Plus

IP05453.pep Sequence

Translation from 96 to 446

> IP05453.pep
MKCIISIVVISMIFGLSLIQAAPIAKDAQNPGFVSATDITGEPVRQKRSS
ADYYQGDYFICYPKSAVYGKHGYGATNRRSYDSEDYAPHYLADDPLVVRQ
ARADARRAAYTDSFGK*

IP05453.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12430-PA 120 GF12430-PA 1..120 1..116 409 70.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22689-PA 116 GG22689-PA 1..116 1..116 448 86.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21948-PA 108 GH21948-PA 1..108 1..116 182 39.5 Plus
Dgri\GH21947-PA 103 GH21947-PA 1..85 1..85 137 41.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13215-PA 116 CG13215-PA 1..116 1..116 605 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19656-PA 100 GI19656-PA 14..84 16..87 142 46.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16754-PA 118 GL16754-PA 1..118 1..116 358 60.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12128-PA 118 GA12128-PA 1..118 1..116 349 58.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20466-PA 116 GM20466-PA 1..116 1..116 449 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25935-PA 116 GD25935-PA 1..116 1..116 516 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15020-PA 110 GJ15020-PA 10..110 12..116 190 46.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20651-PA 120 GK20651-PA 4..120 9..116 244 51.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:03:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13044-PA 116 GE13044-PA 1..116 1..116 451 91.4 Plus