BDGP Sequence Production Resources |
Search the DGRC for IP05453
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 54 |
Well: | 53 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13215-RA |
Protein status: | IP05453.pep: gold |
Preliminary Size: | 351 |
Sequenced Size: | 637 |
Gene | Date | Evidence |
---|---|---|
CG13215 | 2005-01-01 | Successful iPCR screen |
CG13215 | 2008-04-29 | Release 5.5 accounting |
CG13215 | 2008-08-15 | Release 5.9 accounting |
CG13215 | 2008-12-18 | 5.12 accounting |
637 bp (637 high quality bases) assembled on 2006-01-24
GenBank Submission: BT024392
> IP05453.complete AACTCCAGCACCAGTGGACAAACCAAGCCAAGCTTAACTCCAAACTACAA ATCAAAAGCCAACCATCCGCGAAATATATTCAAATATCCGATAAACATGA AGTGCATCATATCCATCGTTGTGATCTCCATGATCTTCGGTTTAAGCCTG ATCCAAGCAGCACCCATCGCTAAGGATGCCCAGAATCCAGGATTCGTTTC GGCCACGGATATTACCGGAGAGCCAGTGCGCCAGAAGCGATCCAGTGCGG ATTACTACCAGGGCGACTATTTCATCTGCTATCCCAAGAGCGCAGTGTAC GGCAAACATGGATACGGTGCAACCAATCGCAGATCCTACGACTCGGAAGA CTATGCGCCCCACTATTTGGCCGACGATCCATTGGTCGTTCGCCAGGCTC GTGCTGATGCCAGACGCGCCGCCTACACCGACAGCTTTGGCAAATAAATC AGGAACTGCCATTTAGTCACTTACTCTATGGATACCAAAATATCCCATCC CCAAAGTTGGGAAACAGAACAGGTCTAGCTAGTAAAGATGTACAAATATT ATTAATATTATTTATTCAACACAAATAAAATAATCAGTAAAAGAATAAAA TAAACTGCAATATATTTAATGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13215-RA | 621 | CG13215-RA | 1..621 | 1..621 | 3105 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 7126960..7127580 | 621..1 | 2985 | 98.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 11239489..11240114 | 626..1 | 3130 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 11240688..11241313 | 626..1 | 3130 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
roo | 9092 | roo DM_ROO 9092bp | 8344..8425 | 541..621 | 119 | 62.2 | Plus |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 750..796 | 568..614 | 118 | 72.3 | Plus |
mdg1 | 7480 | mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). | 6783..6873 | 529..620 | 115 | 59.8 | Plus |
Burdock | 6411 | Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). | 495..564 | 534..602 | 113 | 64.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7126960..7127580 | 1..621 | 95 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..351 | 97..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..351 | 97..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..351 | 97..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..351 | 97..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..351 | 97..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..351 | 97..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..621 | 1..621 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..621 | 1..621 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..351 | 97..447 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13215-RA | 1..621 | 1..621 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11239494..11240114 | 1..621 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11239494..11240114 | 1..621 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11239494..11240114 | 1..621 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7126999..7127619 | 1..621 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11240693..11241313 | 1..621 | 100 | Minus |
Translation from 0 to 446
> IP05453.hyp NSSTSGQTKPSLTPNYKSKANHPRNIFKYPINMKCIISIVVISMIFGLSL IQAAPIAKDAQNPGFVSATDITGEPVRQKRSSADYYQGDYFICYPKSAVY GKHGYGATNRRSYDSEDYAPHYLADDPLVVRQARADARRAAYTDSFGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13215-PA | 116 | CG13215-PA | 1..116 | 33..148 | 605 | 100 | Plus |
Translation from 96 to 446
> IP05453.pep MKCIISIVVISMIFGLSLIQAAPIAKDAQNPGFVSATDITGEPVRQKRSS ADYYQGDYFICYPKSAVYGKHGYGATNRRSYDSEDYAPHYLADDPLVVRQ ARADARRAAYTDSFGK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12430-PA | 120 | GF12430-PA | 1..120 | 1..116 | 409 | 70.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22689-PA | 116 | GG22689-PA | 1..116 | 1..116 | 448 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21948-PA | 108 | GH21948-PA | 1..108 | 1..116 | 182 | 39.5 | Plus |
Dgri\GH21947-PA | 103 | GH21947-PA | 1..85 | 1..85 | 137 | 41.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13215-PA | 116 | CG13215-PA | 1..116 | 1..116 | 605 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19656-PA | 100 | GI19656-PA | 14..84 | 16..87 | 142 | 46.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL16754-PA | 118 | GL16754-PA | 1..118 | 1..116 | 358 | 60.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12128-PA | 118 | GA12128-PA | 1..118 | 1..116 | 349 | 58.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20466-PA | 116 | GM20466-PA | 1..116 | 1..116 | 449 | 94.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25935-PA | 116 | GD25935-PA | 1..116 | 1..116 | 516 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15020-PA | 110 | GJ15020-PA | 10..110 | 12..116 | 190 | 46.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20651-PA | 120 | GK20651-PA | 4..120 | 9..116 | 244 | 51.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13044-PA | 116 | GE13044-PA | 1..116 | 1..116 | 451 | 91.4 | Plus |