Clone IP05455 Report

Search the DGRC for IP05455

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:54
Well:55
Vector:pOT2
Associated Gene/TranscriptCG13314-RA
Protein status:IP05455.pep: gold
Preliminary Size:381
Sequenced Size:810

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13314 2005-01-01 Successful iPCR screen
CG13314 2008-04-29 Release 5.5 accounting
CG13314 2008-08-15 Release 5.9 accounting
CG13314 2008-12-18 5.12 accounting

Clone Sequence Records

IP05455.complete Sequence

810 bp (810 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023648

> IP05455.complete
ATTTAGTTCGCGGCCAGTCCAATTCTTATCAATAAAAAAAAGCCAGTTCC
AAGTTGCAAAAAAGTTCATGGATTAGCAACTGTAACAGTTTGAGCCAAGA
TCTCCGCGTTGCCCACTCCATTGGCCATATGCGATAATTGATTTTCCCGT
ACATAATTTATGACGCACGAAACTGACAGCCGACTTGTAGATTAAAAACT
GCCACTGACCAGCGGCAATAAATCTGTCCGTATCGCTTTATTAGAACGTT
GGACAATAATGCCAGCTCCTGCTCCTTTTCTCCCCTCCAGCAGCCAATCA
TGCCGACCGCCTGCCAAGTAACGCTGCTCGCTGGATGCCTGCTTCTGGCC
ATGAGTTCGGTTCGGGCCCAGTTCTTCTACCACCAGGCGCTGGGTCTGCC
GGTTGCGCACGCTTACGAACCGGCCAATCCGTACCAGGGATATGCAACAG
CCGATGCCCATCCCTCGGTGGTGCGAAATGCCCAGTGGGAGTCTGAGTTG
CCGGCTGAGCTGTCGAAGAGTGCGCGGTTCTACAATGATCCCGTGATCGC
TGCCAATCTGGCCAAGGAATCACTGCTCACGAAGAAGGAAATGGCAGTGG
TACATCGTGAGGCGGAGAAAATACCGCGCGAACAGGTGTACAAGCTCTTC
AAGAACGCCGGCTATCTGAGTAGCAGATAGAACTCACGATGCCAGATGAG
TTCCGTTCCCCACGTGCCTTGTTGTATTTTAGCTTGTAAATTGTTAATAT
ATTGTACATAGTACTCTACATATTAAATGTTTTTTCTATAAAAAAAAAAA
AAAAAAAAAA

IP05455.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13314-RA 789 CG13314-RA 1..789 1..789 3945 100 Plus
CG13314.c 630 CG13314.c 132..630 291..789 2495 100 Plus
CG13314.b 634 CG13314.b 136..634 291..789 2495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8974461..8975249 1..789 3945 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8982424..8983215 1..792 3960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8975524..8976315 1..792 3960 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:37:08 has no hits.

IP05455.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:38:18 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8974461..8975249 1..789 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:01 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..381 300..680 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:37 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RB 1..381 300..680 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:51:42 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..381 300..680 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:05 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..381 300..680 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:44:46 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..381 300..680 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:58 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..381 300..680 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:37 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..789 1..789 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:51:42 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..789 1..789 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:05 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..381 300..680 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:44:46 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
CG13314-RA 1..789 1..789 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:18 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8982424..8983212 1..789 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:18 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8982424..8983212 1..789 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:18 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8982424..8983212 1..789 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:51:42 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8975524..8976312 1..789 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:36 Download gff for IP05455.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8975524..8976312 1..789 100   Plus

IP05455.hyp Sequence

Translation from 299 to 679

> IP05455.hyp
MPTACQVTLLAGCLLLAMSSVRAQFFYHQALGLPVAHAYEPANPYQGYAT
ADAHPSVVRNAQWESELPAELSKSARFYNDPVIAANLAKESLLTKKEMAV
VHREAEKIPREQVYKLFKNAGYLSSR*

IP05455.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13314-PB 126 CG13314-PB 1..126 1..126 647 100 Plus
CG13314-PA 126 CG13314-PA 1..126 1..126 647 100 Plus

IP05455.pep Sequence

Translation from 299 to 679

> IP05455.pep
MPTACQVTLLAGCLLLAMSSVRAQFFYHQALGLPVAHAYEPANPYQGYAT
ADAHPSVVRNAQWESELPAELSKSARFYNDPVIAANLAKESLLTKKEMAV
VHREAEKIPREQVYKLFKNAGYLSSR*

IP05455.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24370-PA 131 GF24370-PA 13..131 9..126 537 86.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14365-PA 126 GG14365-PA 1..126 1..126 644 96.8 Plus
Dere\GG21276-PA 123 GG21276-PA 50..120 54..126 134 39.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16537-PA 126 GH16537-PA 1..126 1..126 478 77.8 Plus
Dgri\GH10407-PA 217 GH10407-PA 144..214 54..126 134 38.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13314-PB 126 CG13314-PB 1..126 1..126 647 100 Plus
CG13314-PA 126 CG13314-PA 1..126 1..126 647 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13826-PA 141 GI13826-PA 15..141 2..126 520 78.7 Plus
Dmoj\GI23271-PA 107 GI23271-PA 34..104 54..126 132 39.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15072-PA 126 GL15072-PA 1..126 1..126 581 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12195-PA 126 GA12195-PA 1..126 1..126 581 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25109-PA 126 GM25109-PA 1..126 1..126 665 100 Plus
Dsec\GM23389-PA 91 GM23389-PA 18..88 54..126 134 39.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14145-PA 126 GD14145-PA 1..126 1..126 665 100 Plus
Dsim\GD24298-PA 117 GD24298-PA 44..114 54..126 136 39.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11692-PA 138 GJ11692-PA 31..138 19..126 508 88 Plus
Dvir\GJ23781-PA 131 GJ23781-PA 58..128 54..126 133 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12349-PA 132 GK12349-PA 27..132 21..126 470 84.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20796-PA 126 GE20796-PA 1..126 1..126 652 97.6 Plus
Dyak\GE12892-PA 151 GE12892-PA 78..148 54..126 134 39.7 Plus