BDGP Sequence Production Resources |
Search the DGRC for IP05455
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 54 |
Well: | 55 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13314-RA |
Protein status: | IP05455.pep: gold |
Preliminary Size: | 381 |
Sequenced Size: | 810 |
Gene | Date | Evidence |
---|---|---|
CG13314 | 2005-01-01 | Successful iPCR screen |
CG13314 | 2008-04-29 | Release 5.5 accounting |
CG13314 | 2008-08-15 | Release 5.9 accounting |
CG13314 | 2008-12-18 | 5.12 accounting |
810 bp (810 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023648
> IP05455.complete ATTTAGTTCGCGGCCAGTCCAATTCTTATCAATAAAAAAAAGCCAGTTCC AAGTTGCAAAAAAGTTCATGGATTAGCAACTGTAACAGTTTGAGCCAAGA TCTCCGCGTTGCCCACTCCATTGGCCATATGCGATAATTGATTTTCCCGT ACATAATTTATGACGCACGAAACTGACAGCCGACTTGTAGATTAAAAACT GCCACTGACCAGCGGCAATAAATCTGTCCGTATCGCTTTATTAGAACGTT GGACAATAATGCCAGCTCCTGCTCCTTTTCTCCCCTCCAGCAGCCAATCA TGCCGACCGCCTGCCAAGTAACGCTGCTCGCTGGATGCCTGCTTCTGGCC ATGAGTTCGGTTCGGGCCCAGTTCTTCTACCACCAGGCGCTGGGTCTGCC GGTTGCGCACGCTTACGAACCGGCCAATCCGTACCAGGGATATGCAACAG CCGATGCCCATCCCTCGGTGGTGCGAAATGCCCAGTGGGAGTCTGAGTTG CCGGCTGAGCTGTCGAAGAGTGCGCGGTTCTACAATGATCCCGTGATCGC TGCCAATCTGGCCAAGGAATCACTGCTCACGAAGAAGGAAATGGCAGTGG TACATCGTGAGGCGGAGAAAATACCGCGCGAACAGGTGTACAAGCTCTTC AAGAACGCCGGCTATCTGAGTAGCAGATAGAACTCACGATGCCAGATGAG TTCCGTTCCCCACGTGCCTTGTTGTATTTTAGCTTGTAAATTGTTAATAT ATTGTACATAGTACTCTACATATTAAATGTTTTTTCTATAAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 8974461..8975249 | 1..789 | 3945 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 8982424..8983215 | 1..792 | 3960 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 8975524..8976315 | 1..792 | 3960 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 8974461..8975249 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..381 | 300..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RB | 1..381 | 300..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..381 | 300..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..381 | 300..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..381 | 300..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..381 | 300..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..789 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..789 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..381 | 300..680 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13314-RA | 1..789 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8982424..8983212 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8982424..8983212 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8982424..8983212 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 8975524..8976312 | 1..789 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 8975524..8976312 | 1..789 | 100 | Plus |
Translation from 299 to 679
> IP05455.hyp MPTACQVTLLAGCLLLAMSSVRAQFFYHQALGLPVAHAYEPANPYQGYAT ADAHPSVVRNAQWESELPAELSKSARFYNDPVIAANLAKESLLTKKEMAV VHREAEKIPREQVYKLFKNAGYLSSR*
Translation from 299 to 679
> IP05455.pep MPTACQVTLLAGCLLLAMSSVRAQFFYHQALGLPVAHAYEPANPYQGYAT ADAHPSVVRNAQWESELPAELSKSARFYNDPVIAANLAKESLLTKKEMAV VHREAEKIPREQVYKLFKNAGYLSSR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24370-PA | 131 | GF24370-PA | 13..131 | 9..126 | 537 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14365-PA | 126 | GG14365-PA | 1..126 | 1..126 | 644 | 96.8 | Plus |
Dere\GG21276-PA | 123 | GG21276-PA | 50..120 | 54..126 | 134 | 39.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16537-PA | 126 | GH16537-PA | 1..126 | 1..126 | 478 | 77.8 | Plus |
Dgri\GH10407-PA | 217 | GH10407-PA | 144..214 | 54..126 | 134 | 38.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13314-PB | 126 | CG13314-PB | 1..126 | 1..126 | 647 | 100 | Plus |
CG13314-PA | 126 | CG13314-PA | 1..126 | 1..126 | 647 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13826-PA | 141 | GI13826-PA | 15..141 | 2..126 | 520 | 78.7 | Plus |
Dmoj\GI23271-PA | 107 | GI23271-PA | 34..104 | 54..126 | 132 | 39.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15072-PA | 126 | GL15072-PA | 1..126 | 1..126 | 581 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12195-PA | 126 | GA12195-PA | 1..126 | 1..126 | 581 | 85.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25109-PA | 126 | GM25109-PA | 1..126 | 1..126 | 665 | 100 | Plus |
Dsec\GM23389-PA | 91 | GM23389-PA | 18..88 | 54..126 | 134 | 39.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14145-PA | 126 | GD14145-PA | 1..126 | 1..126 | 665 | 100 | Plus |
Dsim\GD24298-PA | 117 | GD24298-PA | 44..114 | 54..126 | 136 | 39.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11692-PA | 138 | GJ11692-PA | 31..138 | 19..126 | 508 | 88 | Plus |
Dvir\GJ23781-PA | 131 | GJ23781-PA | 58..128 | 54..126 | 133 | 38.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12349-PA | 132 | GK12349-PA | 27..132 | 21..126 | 470 | 84.9 | Plus |