BDGP Sequence Production Resources |
Search the DGRC for IP05486
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 54 |
Well: | 86 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13984-RA |
Protein status: | IP05486.pep: gold |
Preliminary Size: | 303 |
Sequenced Size: | 681 |
Gene | Date | Evidence |
---|---|---|
CG13984 | 2005-01-01 | Successful iPCR screen |
CG13984 | 2008-04-29 | Release 5.5 accounting |
CG13984 | 2008-08-15 | Release 5.9 accounting |
CG13984 | 2008-12-18 | 5.12 accounting |
681 bp (681 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023645
> IP05486.complete CAGGCGCGTAGAGGAGCATCAGATCTAAAATTTTCAGTTTTTGACATTAT GGAGTATCAGCACTATTTGCAGAATGAGCTGACCATTTTCCACTACCACC TACTCTTCGACTATGGAGCACCGATCCAGGTGGCCACTTGCATTGCCTTC GGCGTCGTCTGCGGCTGGATAATGAGCCTGATCACATTCGTTGTCTACAA GGCAGCAATTGGCCTGGGCGCCAAAGCCACGGCATGTGACAACGATGATA AGTACGATGATCTCGACCTGGACATGCATGGGGAGTATGGGTATGACCGG ATGTTGTCCCAGTGCCAGGACCTTAGTGATTGGCTTGTGAGGACACAGTA GCTTAGACAGGATAACGCCTGAGGGGGCATTCGATTCGCCTTCTCTGTGC ATGAGCCCCAATCAAAGTATCTCCACGCCACTTAGACCGTCTCGAGTGCG CTGAGTGAATTTTTCAGATACTGTTACAGTGGCAGTATCGGATATTTTCT CTGCCGTTCTCGAAGTCATTAGCATAATGTATCTCGACACTGTCATGGCC TTAAATTGAATTCAGCATGCACCGCAGGCCGTCATTTATGCAAGTTTATT TCTATAGACGAAGGCCGGAGGTTCCAAATATTTAATAAACCAAACCGTTT CTGTTTGAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13984-RA | 657 | CG13984-RA | 1..657 | 1..657 | 3285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 6307869..6308525 | 1..657 | 3285 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 6308819..6309480 | 1..662 | 3310 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 6308819..6309480 | 1..662 | 3310 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 6307869..6308525 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..303 | 49..351 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..303 | 49..351 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..303 | 49..351 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..303 | 49..351 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..303 | 49..351 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..303 | 49..351 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..657 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..657 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..303 | 49..351 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13984-RA | 1..657 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6308819..6309475 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6308819..6309475 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6308819..6309475 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 6308819..6309475 | 1..657 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 6308819..6309475 | 1..657 | 100 | Plus |
Translation from 0 to 350
> IP05486.hyp QARRGASDLKFSVFDIMEYQHYLQNELTIFHYHLLFDYGAPIQVATCIAF GVVCGWIMSLITFVVYKAAIGLGAKATACDNDDKYDDLDLDMHGEYGYDR MLSQCQDLSDWLVRTQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13984-PA | 100 | CG13984-PA | 1..100 | 17..116 | 548 | 100 | Plus |
Translation from 48 to 350
> IP05486.pep MEYQHYLQNELTIFHYHLLFDYGAPIQVATCIAFGVVCGWIMSLITFVVY KAAIGLGAKATACDNDDKYDDLDLDMHGEYGYDRMLSQCQDLSDWLVRTQ *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14514-PA | 249 | GF14514-PA | 1..60 | 1..60 | 200 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10401-PA | 107 | GG10401-PA | 1..100 | 1..100 | 445 | 82 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10735-PA | 101 | GH10735-PA | 1..53 | 1..53 | 177 | 58.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13984-PA | 100 | CG13984-PA | 1..100 | 1..100 | 548 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11488-PA | 99 | GI11488-PA | 1..75 | 1..76 | 184 | 52.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18618-PA | 127 | GM18618-PA | 1..99 | 1..99 | 423 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23399-PA | 100 | GD23399-PA | 1..100 | 1..100 | 424 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12762-PA | 104 | GJ12762-PA | 1..53 | 1..53 | 177 | 60.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14751-PA | 87 | GK14751-PA | 1..56 | 1..56 | 156 | 51.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13769-PA | 100 | GE13769-PA | 1..100 | 1..100 | 444 | 81 | Plus |