Clone IP05490 Report

Search the DGRC for IP05490

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:54
Well:90
Vector:pOT2
Associated Gene/TranscriptCG14072-RA
Protein status:IP05490.pep: gold
Preliminary Size:366
Sequenced Size:538

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14072 2005-01-01 Successful iPCR screen
CG14072 2008-04-29 Release 5.5 accounting
CG14072 2008-08-15 Release 5.9 accounting
CG14072 2008-12-18 5.12 accounting

Clone Sequence Records

IP05490.complete Sequence

538 bp (538 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024388

> IP05490.complete
ACGAATCCGTATGCCAAATTGAAATCACAGCCATGGATGGTCTACAATAT
GCGGTCGAGTTTGCCCACGATGATAACCTACTGGGTGGTAGCCCATCGAA
TGTGTCTCAACTCTCGGAATTTCTGGCCATGCTCACCCTTAAGTCAGCCG
AGGAACGCAATGATGACGGCCAAAACCGTCATGACAAGCTCTTACAATTC
AAACGGGAAGCCGATTTGCTGGCAACCAAATTTGATTCGCCCGATTATTA
CACCCAAAAGGAGGAATTAATCTTCAAGGTCGTGTGTGAATTGCGGGGCA
TTGACCACGAGAAGTGGCTCCTGGATGAAATGGGACTCATGGATGAAGAT
GCATTTGGTGATTTTCTGCAGGATGCGTTTGTTGGCAATGGAGATTGAGT
AACAGCTTCTTGTTTTTAAGCTCTGATTCATTGTAAGAAACATTTACCTT
TTGGAATCTATTAACTAACAACCAAGAAATAAATCTTGAAATGAAATCAG
CACATCACCTAGCTGTCAGCCAAAAAAAAAAAAAAAAA

IP05490.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14072-RA 574 CG14072-RA 53..574 1..522 2610 100 Plus
CG14072.c 682 CG14072.c 161..682 1..522 2610 100 Plus
CG14072.b 749 CG14072.b 192..713 1..522 2610 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10936275..10936692 104..521 2090 100 Plus
chr2L 23010047 chr2L 10936114..10936217 1..104 520 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10937514..10937932 104..522 2095 100 Plus
2L 23513712 2L 10937353..10937456 1..104 520 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10937514..10937932 104..522 2095 100 Plus
2L 23513712 2L 10937353..10937456 1..104 520 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:41:39 has no hits.

IP05490.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:42:17 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10936114..10936217 1..104 100 -> Plus
chr2L 10936276..10936692 105..521 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:11 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 1..366 33..398 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:35 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 1..366 33..398 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:38 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 1..366 33..398 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:45 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 1..366 33..398 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:46:46 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 1..366 33..398 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:59 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 20..540 1..521 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:35 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 20..540 1..521 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:38 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 1..521 1..521 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:45 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 20..540 1..521 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:46:46 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
CG14072-RA 1..521 1..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:17 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10937353..10937456 1..104 100 -> Plus
2L 10937515..10937931 105..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:17 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10937353..10937456 1..104 100 -> Plus
2L 10937515..10937931 105..521 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:17 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10937353..10937456 1..104 100 -> Plus
2L 10937515..10937931 105..521 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:38 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10937353..10937456 1..104 100 -> Plus
arm_2L 10937515..10937931 105..521 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:00 Download gff for IP05490.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10937353..10937456 1..104 100 -> Plus
2L 10937515..10937931 105..521 100   Plus

IP05490.hyp Sequence

Translation from 2 to 397

> IP05490.hyp
ESVCQIEITAMDGLQYAVEFAHDDNLLGGSPSNVSQLSEFLAMLTLKSAE
ERNDDGQNRHDKLLQFKREADLLATKFDSPDYYTQKEELIFKVVCELRGI
DHEKWLLDEMGLMDEDAFGDFLQDAFVGNGD*

IP05490.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG14072-PC 121 CG14072-PC 1..121 11..131 634 100 Plus
CG14072-PB 121 CG14072-PB 1..121 11..131 634 100 Plus
CG14072-PA 121 CG14072-PA 1..121 11..131 634 100 Plus

IP05490.pep Sequence

Translation from 32 to 397

> IP05490.pep
MDGLQYAVEFAHDDNLLGGSPSNVSQLSEFLAMLTLKSAEERNDDGQNRH
DKLLQFKREADLLATKFDSPDYYTQKEELIFKVVCELRGIDHEKWLLDEM
GLMDEDAFGDFLQDAFVGNGD*

IP05490.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:11:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15833-PA 122 GF15833-PA 2..114 3..121 212 43.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:11:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23684-PA 120 GG23684-PA 1..120 1..121 421 71.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14072-PC 121 CG14072-PC 1..121 1..121 634 100 Plus
CG14072-PB 121 CG14072-PB 1..121 1..121 634 100 Plus
CG14072-PA 121 CG14072-PA 1..121 1..121 634 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22873-PA 94 GL22873-PA 1..93 1..99 206 48 Plus
Dper\GL19128-PA 94 GL19128-PA 1..93 1..99 206 48 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12744-PA 94 GA12744-PA 1..93 1..99 218 49 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18763-PA 121 GM18763-PA 1..121 1..121 551 89.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23742-PA 121 GD23742-PA 1..121 1..121 578 92.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16251-PA 111 GJ16251-PA 3..101 4..98 131 38.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:11:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18496-PA 120 GE18496-PA 1..116 1..117 481 81.2 Plus