IP05490.complete Sequence
538 bp (538 high quality bases) assembled on 2006-01-26
GenBank Submission: BT024388
> IP05490.complete
ACGAATCCGTATGCCAAATTGAAATCACAGCCATGGATGGTCTACAATAT
GCGGTCGAGTTTGCCCACGATGATAACCTACTGGGTGGTAGCCCATCGAA
TGTGTCTCAACTCTCGGAATTTCTGGCCATGCTCACCCTTAAGTCAGCCG
AGGAACGCAATGATGACGGCCAAAACCGTCATGACAAGCTCTTACAATTC
AAACGGGAAGCCGATTTGCTGGCAACCAAATTTGATTCGCCCGATTATTA
CACCCAAAAGGAGGAATTAATCTTCAAGGTCGTGTGTGAATTGCGGGGCA
TTGACCACGAGAAGTGGCTCCTGGATGAAATGGGACTCATGGATGAAGAT
GCATTTGGTGATTTTCTGCAGGATGCGTTTGTTGGCAATGGAGATTGAGT
AACAGCTTCTTGTTTTTAAGCTCTGATTCATTGTAAGAAACATTTACCTT
TTGGAATCTATTAACTAACAACCAAGAAATAAATCTTGAAATGAAATCAG
CACATCACCTAGCTGTCAGCCAAAAAAAAAAAAAAAAA
IP05490.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:19:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14072-RA | 574 | CG14072-RA | 53..574 | 1..522 | 2610 | 100 | Plus |
CG14072.c | 682 | CG14072.c | 161..682 | 1..522 | 2610 | 100 | Plus |
CG14072.b | 749 | CG14072.b | 192..713 | 1..522 | 2610 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:41:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 10936275..10936692 | 104..521 | 2090 | 100 | Plus |
chr2L | 23010047 | chr2L | 10936114..10936217 | 1..104 | 520 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:41:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10937514..10937932 | 104..522 | 2095 | 100 | Plus |
2L | 23513712 | 2L | 10937353..10937456 | 1..104 | 520 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10937514..10937932 | 104..522 | 2095 | 100 | Plus |
2L | 23513712 | 2L | 10937353..10937456 | 1..104 | 520 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 08:41:39 has no hits.
IP05490.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:42:17 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 10936114..10936217 | 1..104 | 100 | -> | Plus |
chr2L | 10936276..10936692 | 105..521 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:11 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 1..366 | 33..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:33:35 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 1..366 | 33..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:52:38 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 1..366 | 33..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:07:45 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 1..366 | 33..398 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:46:46 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 1..366 | 33..398 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:59 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 20..540 | 1..521 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:33:35 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 20..540 | 1..521 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:38 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 1..521 | 1..521 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:07:45 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 20..540 | 1..521 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:46:46 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14072-RA | 1..521 | 1..521 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:17 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10937353..10937456 | 1..104 | 100 | -> | Plus |
2L | 10937515..10937931 | 105..521 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:17 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10937353..10937456 | 1..104 | 100 | -> | Plus |
2L | 10937515..10937931 | 105..521 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:42:17 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10937353..10937456 | 1..104 | 100 | -> | Plus |
2L | 10937515..10937931 | 105..521 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:38 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10937353..10937456 | 1..104 | 100 | -> | Plus |
arm_2L | 10937515..10937931 | 105..521 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:00 Download gff for
IP05490.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10937353..10937456 | 1..104 | 100 | -> | Plus |
2L | 10937515..10937931 | 105..521 | 100 | | Plus |
IP05490.hyp Sequence
Translation from 2 to 397
> IP05490.hyp
ESVCQIEITAMDGLQYAVEFAHDDNLLGGSPSNVSQLSEFLAMLTLKSAE
ERNDDGQNRHDKLLQFKREADLLATKFDSPDYYTQKEELIFKVVCELRGI
DHEKWLLDEMGLMDEDAFGDFLQDAFVGNGD*
IP05490.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14072-PC | 121 | CG14072-PC | 1..121 | 11..131 | 634 | 100 | Plus |
CG14072-PB | 121 | CG14072-PB | 1..121 | 11..131 | 634 | 100 | Plus |
CG14072-PA | 121 | CG14072-PA | 1..121 | 11..131 | 634 | 100 | Plus |
IP05490.pep Sequence
Translation from 32 to 397
> IP05490.pep
MDGLQYAVEFAHDDNLLGGSPSNVSQLSEFLAMLTLKSAEERNDDGQNRH
DKLLQFKREADLLATKFDSPDYYTQKEELIFKVVCELRGIDHEKWLLDEM
GLMDEDAFGDFLQDAFVGNGD*
IP05490.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:11:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15833-PA | 122 | GF15833-PA | 2..114 | 3..121 | 212 | 43.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:11:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23684-PA | 120 | GG23684-PA | 1..120 | 1..121 | 421 | 71.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14072-PC | 121 | CG14072-PC | 1..121 | 1..121 | 634 | 100 | Plus |
CG14072-PB | 121 | CG14072-PB | 1..121 | 1..121 | 634 | 100 | Plus |
CG14072-PA | 121 | CG14072-PA | 1..121 | 1..121 | 634 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:11:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL22873-PA | 94 | GL22873-PA | 1..93 | 1..99 | 206 | 48 | Plus |
Dper\GL19128-PA | 94 | GL19128-PA | 1..93 | 1..99 | 206 | 48 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:11:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12744-PA | 94 | GA12744-PA | 1..93 | 1..99 | 218 | 49 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:11:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18763-PA | 121 | GM18763-PA | 1..121 | 1..121 | 551 | 89.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:11:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23742-PA | 121 | GD23742-PA | 1..121 | 1..121 | 578 | 92.6 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:11:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ16251-PA | 111 | GJ16251-PA | 3..101 | 4..98 | 131 | 38.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:11:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18496-PA | 120 | GE18496-PA | 1..116 | 1..117 | 481 | 81.2 | Plus |