Clone IP05492 Report

Search the DGRC for IP05492

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:54
Well:92
Vector:pOT2
Associated Gene/Transcriptpallidin-RC
Protein status:IP05492.pep: wuzgold
Preliminary Size:363
Sequenced Size:881

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14133 2005-01-01 Successful iPCR screen
CG14133 2008-04-29 Release 5.5 accounting
CG14133 2008-08-15 Release 5.9 accounting
CG14133 2008-12-18 5.12 accounting

Clone Sequence Records

IP05492.complete Sequence

881 bp (881 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023646

> IP05492.complete
CTAGTGTCCTCAACGAACTCCCTAATGACCCAGCAAGGGATTCCACCGCC
CAATCTTCTCACAATGGAAAACCAAAACAAGATGCGGAAACCTGTTGCTC
CTCCCAGGACAACGAAGTCATGGCCAGTCTAGCCGCTTTACAGTTGTCCG
CTGGCGTCCTGCAAATAGCGGAGCCTCCACTAAACCATGTGCGCACCCAG
CTTAGGGAATTGATCGGTAGGCAGAACAAAACATACATCGATTTGTCCAA
GGAGAAATATAAACTGGACTGCAGCGAAGTGGCCAGGCTGAATGATATGA
TGAGCGATGTAAAGCGATACAAAGATAAGCTAACAAAAATCAAGAAGGAA
ATGCAGGGCGTCTATCAGCGCACCAAAGAGTTAAAGAAACGAGCCGCTAA
CGTGGCGGCCTGCAAGCAGCGTGACTACCAGCGGAAACTCGAGAGGCTAC
AGCACGAGGAGTCGCTCATTGGCAGCCAGTAGACGAAGGGGATCAGTCAA
CACCTAACCAGGTGTCTCCCGGAATCTTCAAGCTACCTGTACCACCTCGT
TAAAGCGCATTTACATTGGGATTTCCGTTTACAACTAGCCAATATTGTAA
CAGATAACAGTTGAACAAAAGTTAAACCATTTGAATACATAATAATAATA
ATTATAATAATAACTGTATACGTTATAAGACCAGGCTATCGTATGTCTGC
GATTAGTTGGAAAACATTACATTGTATATTGTGTATAGTTAAGTAAGCAC
TTAAGAGATTTCACAGAAAAAAAAAGATAAATGCGTCCAATGAGTAAAGG
AAGCAAATTACTACTATACATTTAGCTGCAAATATTATTTATAAATATAC
AAATATTTATGTTTAAAAAAAAAAAAAAAAA

IP05492.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14133-RC 926 CG14133-RC 20..885 1..866 4330 100 Plus
CG14133.a 1040 CG14133.a 557..1040 381..864 2405 99.7 Plus
CG14133.b 1054 CG14133.b 571..1054 381..864 2405 99.7 Plus
CG14133.a 1040 CG14133.a 90..302 2..214 1065 100 Plus
CG14133.b 1054 CG14133.b 114..326 2..214 1065 100 Plus
CG14133.a 1040 CG14133.a 361..532 215..386 860 100 Plus
CG14133.b 1054 CG14133.b 385..556 215..386 860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11680519..11681002 864..381 2405 99.8 Minus
chr3L 24539361 chr3L 11681932..11682145 214..1 1070 100 Minus
chr3L 24539361 chr3L 11681114..11681201 386..299 440 100 Minus
chr3L 24539361 chr3L 11681789..11681873 299..215 425 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11689629..11690114 866..381 2415 99.8 Minus
3L 28110227 3L 11691040..11691253 214..1 1070 100 Minus
3L 28110227 3L 11690226..11690313 386..299 440 100 Minus
3L 28110227 3L 11690897..11690981 299..215 425 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11682729..11683214 866..381 2415 99.7 Minus
3L 28103327 3L 11684140..11684353 214..1 1070 100 Minus
3L 28103327 3L 11683326..11683413 386..299 440 100 Minus
3L 28103327 3L 11683997..11684081 299..215 425 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:04:52 has no hits.

IP05492.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:06:07 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11680556..11680996 387..827 94 <- Minus
chr3L 11681114..11681200 300..386 100 <- Minus
chr3L 11681789..11681873 215..299 100 <- Minus
chr3L 11681932..11682145 1..214 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:15 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
CG14133-RB 23..504 1..482 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:22 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RB 23..504 1..482 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:44 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RB 23..504 1..482 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:50 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
CG14133-RA 1..363 120..482 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:09:24 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
Pallidin-RB 23..504 1..482 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:28 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
CG14133-RB 89..952 1..864 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:22 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RC 1..864 1..864 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:44 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
pallidin-RB 89..952 1..864 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:50 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
CG14133-RA 1..363 120..482 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:09:24 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
Pallidin-RB 89..952 1..864 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:07 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691040..11691253 1..214 100   Minus
3L 11689631..11690108 387..864 100 <- Minus
3L 11690226..11690312 300..386 100 <- Minus
3L 11690897..11690981 215..299 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:07 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691040..11691253 1..214 100   Minus
3L 11689631..11690108 387..864 100 <- Minus
3L 11690226..11690312 300..386 100 <- Minus
3L 11690897..11690981 215..299 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:07 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11691040..11691253 1..214 100   Minus
3L 11689631..11690108 387..864 100 <- Minus
3L 11690226..11690312 300..386 100 <- Minus
3L 11690897..11690981 215..299 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:44 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11682731..11683208 387..864 100 <- Minus
arm_3L 11683326..11683412 300..386 100 <- Minus
arm_3L 11683997..11684081 215..299 100 <- Minus
arm_3L 11684140..11684353 1..214 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:21 Download gff for IP05492.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11682731..11683208 387..864 100 <- Minus
3L 11683326..11683412 300..386 100 <- Minus
3L 11683997..11684081 215..299 100 <- Minus
3L 11684140..11684353 1..214 100   Minus

IP05492.hyp Sequence

Translation from 2 to 481

> IP05492.hyp
SVLNELPNDPARDSTAQSSHNGKPKQDAETCCSSQDNEVMASLAALQLSA
GVLQIAEPPLNHVRTQLRELIGRQNKTYIDLSKEKYKLDCSEVARLNDMM
SDVKRYKDKLTKIKKEMQGVYQRTKELKKRAANVAACKQRDYQRKLERLQ
HEESLIGSQ*

IP05492.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:31
Subject Length Description Subject Range Query Range Score Percent Strand
Pallidin-PB 167 CG14133-PB 9..167 1..159 807 100 Plus

IP05492.pep Sequence

Translation from 119 to 481

> IP05492.pep
MASLAALQLSAGVLQIAEPPLNHVRTQLRELIGRQNKTYIDLSKEKYKLD
CSEVARLNDMMSDVKRYKDKLTKIKKEMQGVYQRTKELKKRAANVAACKQ
RDYQRKLERLQHEESLIGSQ*

IP05492.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24525-PA 169 GF24525-PA 53..169 4..120 543 86.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13899-PA 120 GG13899-PA 1..120 1..120 599 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16625-PA 161 GH16625-PA 42..159 3..120 499 80.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
Pldn-PB 167 CG14133-PB 48..167 1..120 599 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11582-PA 119 GI11582-PA 1..116 4..119 398 72.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16344-PA 173 GL16344-PA 53..170 3..120 551 87.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12783-PA 173 GA12783-PA 52..170 2..120 552 86.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24723-PA 120 GM24723-PA 1..120 1..120 610 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12785-PA 120 GD12785-PA 1..120 1..120 614 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11261-PA 161 GJ11261-PA 42..159 3..120 477 76.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:06:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12407-PA 149 GK12407-PA 32..147 5..120 518 85.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20189-PA 167 GE20189-PA 48..167 1..120 602 95.8 Plus