Clone IP05502 Report

Search the DGRC for IP05502

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:55
Well:2
Vector:pOT2
Associated Gene/Transcriptl(2)37Cg-RA
Protein status:IP05502.pep: gold
Preliminary Size:318
Sequenced Size:423

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10685 2005-01-01 Successful iPCR screen
l(2)37Cg 2008-04-29 Release 5.5 accounting
l(2)37Cg 2008-08-15 Release 5.9 accounting
l(2)37Cg 2008-12-18 5.12 accounting

Clone Sequence Records

IP05502.complete Sequence

423 bp (423 high quality bases) assembled on 2006-08-03

GenBank Submission: BT028781

> IP05502.complete
GCATGTGCCCTGCACGTTTTTTGTAAACAAACGAACGAGTATTTGAACAA
ACTGAAAATGGGAGCATTGGCAGAGCTGGCTGGTGATGAGAAAAACGGCG
AAGGATCTCGTACTTTTGTGTTCACCAACGAGGGCCACACGCTGGGAAAT
GCGCTGAAAACGATCATAGCCCGCTACCCGGAGGTGGATTTCTGTGGCTA
CACGATTCCGCATCCCACGGAGCAGAAGCTGCACTTCCGCATTCAATCCC
GTCGAGACAGAGCCATAGATATACTTAAACGGGGACTGGAGGATCTGGAG
GGTCTGTGTGATCATACAATCGTTACGTTCGAAAAGGAGATGGCCGAGTT
TAATGCAATGAAAGTGGAAAATTAGATATATATGTATAAAGAATACTTAA
AACTAAAAAAAAAAAAAAAAAAA

IP05502.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Cg-RA 461 l(2)37Cg-RA 58..461 1..404 2020 100 Plus
l(2)37Cg.b 620 l(2)37Cg.b 217..620 1..404 2020 100 Plus
l(2)37Cg.a 398 l(2)37Cg.a 70..398 76..404 1645 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:05:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19131603..19131933 404..74 1655 100 Minus
chr2L 23010047 chr2L 19131989..19132063 75..1 375 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:04:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19133020..19133353 407..74 1670 100 Minus
2L 23513712 2L 19133409..19133483 75..1 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19133020..19133353 407..74 1670 100 Minus
2L 23513712 2L 19133409..19133483 75..1 375 100 Minus
Blast to na_te.dros performed on 2019-03-17 00:04:58 has no hits.

IP05502.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:06:10 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19131603..19131931 76..404 100 <- Minus
chr2L 19131989..19132063 1..75 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:17 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:45:22 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:56:49 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:26:19 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:09:28 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:54:03 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:45:22 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..404 1..404 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:56:49 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..404 1..404 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:26:19 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:09:28 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)37Cg-RA 1..404 1..404 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:10 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19133409..19133483 1..75 100   Minus
2L 19133023..19133351 76..404 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:10 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19133409..19133483 1..75 100   Minus
2L 19133023..19133351 76..404 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:06:10 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19133409..19133483 1..75 100   Minus
2L 19133023..19133351 76..404 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:56:49 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19133023..19133351 76..404 100 <- Minus
arm_2L 19133409..19133483 1..75 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:59:18 Download gff for IP05502.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19133023..19133351 76..404 100 <- Minus
2L 19133409..19133483 1..75 100   Minus

IP05502.hyp Sequence

Translation from 0 to 374

> IP05502.hyp
ACALHVFCKQTNEYLNKLKMGALAELAGDEKNGEGSRTFVFTNEGHTLGN
ALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRDRAIDILKRGLEDLE
GLCDHTIVTFEKEMAEFNAMKVEN*

IP05502.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Cg-PA 105 CG10685-PA 1..105 20..124 551 100 Plus
l(2)37Cg-PC 116 CG10685-PC 8..116 13..124 524 91.1 Plus
l(2)37Cg-PD 132 CG10685-PD 34..132 26..124 523 100 Plus

IP05502.pep Sequence

Translation from 57 to 374

> IP05502.pep
MGALAELAGDEKNGEGSRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTI
PHPTEQKLHFRIQSRRDRAIDILKRGLEDLEGLCDHTIVTFEKEMAEFNA
MKVEN*

IP05502.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15205-PA 106 GF15205-PA 1..105 1..105 522 92.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21646-PA 106 GG21646-PA 1..105 1..105 541 96.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13479-PA 106 GH13479-PA 1..103 1..103 481 86.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)37Cg-PA 105 CG10685-PA 1..105 1..105 551 100 Plus
l(2)37Cg-PC 116 CG10685-PC 18..116 7..105 523 100 Plus
l(2)37Cg-PD 132 CG10685-PD 34..132 7..105 523 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17231-PA 106 GI17231-PA 1..104 1..104 493 89.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21124-PA 110 GL21124-PA 1..103 1..103 498 90.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10493-PA 110 GA10493-PA 1..103 1..103 498 90.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17025-PA 106 GM17025-PA 1..105 1..105 558 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21773-PA 106 GD21773-PA 1..105 1..105 558 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17990-PA 106 GJ17990-PA 1..104 1..104 489 88.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12666-PA 106 GE12666-PA 1..105 1..105 544 97.1 Plus