BDGP Sequence Production Resources |
Search the DGRC for IP05517
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 55 |
Well: | 17 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12012-RA |
Protein status: | IP05517.pep: gold |
Preliminary Size: | 369 |
Sequenced Size: | 849 |
849 bp assembled on 2009-07-28
GenBank Submission: BT088924.1
> IP05517.complete CCTAGACTATTTTCATAACAAGAAGCAGTGAGTCACAAAAAAAAAGCTTT CCGGCCACAATGGCAGATACCCGTAAAGACGCCGCGCCGCCGAGCTACGA AGAAGTCATGAACAGTCCCTCGCAGGATTCCCGGCTGATAGTGGGCGTGC ATCAGGGAGCACCTAGTGCTCCGCCACCAAACATGCACATGCCAACCTAC GGAGCTTTCGAGACGACGCCGGTCAGCGTGGTGATTCAGCCTGCTCCGGT CGCTATGCCCACCGAGATCATCGTGATTGGAGGATGCCCTGCATGTCGGA TTGGATACCTGGAGGACACCTTCTCCGCCTGCGGACTGTGCTGCGCAATC TTCTTCTTCCCGCTGGGAATTCTCTGTTGCTTGGCCATGCGTGAGAAGCG CTGTTCCAACTGCGGAACGGTTTTCTAGAGGGGATTACCCAGAAATTATC CATAAAGAAACGCTAAAAGTTGATCCCTATTAGGCTTTCGCGGTGGGTGA CTATCACAAAGCACCAATATTTTTGTTATTGTTAATCGTTAGCTCGCAAA TCATTATATACTATGTGTAAATATTATTCATGCCAGCCTGCGGAATGCCC CCGATTCCATTCCAGTCCCTGTCCGGAGAATGGTCATGTACAGTGAAATA TGCTAAACTCGAATTCAAATCAGTAAGCCCAGTTATGAAAAAAATGCTAA AAAAAATCAGTTGAACATGTTTTCCAATTGAATAGTGATTTGGCTTTTTA CAAGGATTTTAAGTAACATAAGTTTTAAACTGCAAACAAAAGAAAAAATA TTTATATATTTAAATAAAAGGTTTACAACATGAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12012-RA | 1239 | CG12012-RA | 134..964 | 1..832 | 4120 | 99.8 | Plus |
CG12012.a | 855 | CG12012.a | 38..855 | 1..815 | 3970 | 99.3 | Plus |
CG12012-RB | 902 | CG12012-RB | 213..902 | 126..815 | 3450 | 100 | Plus |
CG12012-RB | 902 | CG12012-RB | 38..162 | 1..126 | 590 | 99.2 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 3376244..3376368 | 1..126 | 99 | -> | Plus |
chr3L | 3376420..3377085 | 127..792 | 100 | == | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RA | 1..369 | 60..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RA | 1..369 | 60..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RA | 1..369 | 60..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RA | 1..369 | 60..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RA | 1..369 | 60..428 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RA | 67..880 | 1..815 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RA | 67..880 | 1..815 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12012-RC | 67..897 | 1..832 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3376823..3376947 | 1..126 | 99 | -> | Plus |
3L | 3376999..3377704 | 127..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3376823..3376947 | 1..126 | 99 | -> | Plus |
3L | 3376999..3377704 | 127..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3376823..3376947 | 1..126 | 99 | -> | Plus |
3L | 3376999..3377704 | 127..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 3376823..3376947 | 1..126 | 99 | -> | Plus |
arm_3L | 3376999..3377704 | 127..832 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 3376999..3377704 | 127..832 | 100 | Plus | |
3L | 3376823..3376947 | 1..126 | 99 | -> | Plus |
Translation from 59 to 427
> IP05517.hyp MADTRKDAAPPSYEEVMNSPSQDSRLIVGVHQGAPSAPPPNMHMPTYGAF ETTPVSVVIQPAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFF PLGILCCLAMREKRCSNCGTVF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12012-PC | 122 | CG12012-PC | 1..122 | 1..122 | 665 | 100 | Plus |
CG12012-PA | 122 | CG12012-PA | 1..122 | 1..122 | 665 | 100 | Plus |
CG12012-PB | 81 | CG12012-PB | 1..81 | 42..122 | 449 | 100 | Plus |
Translation from 59 to 427
> IP05517.pep MADTRKDAAPPSYEEVMNSPSQDSRLIVGVHQGAPSAPPPNMHMPTYGAF ETTPVSVVIQPAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFF PLGILCCLAMREKRCSNCGTVF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24209-PA | 123 | GF24209-PA | 1..123 | 1..122 | 472 | 74.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15138-PA | 122 | GG15138-PA | 1..122 | 1..122 | 634 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23325-PA | 120 | GH23325-PA | 3..120 | 2..122 | 416 | 68.5 | Plus |
Dgri\GH16110-PA | 120 | GH16110-PA | 3..120 | 2..122 | 416 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12012-PC | 122 | CG12012-PC | 1..122 | 1..122 | 665 | 100 | Plus |
CG12012-PA | 122 | CG12012-PA | 1..122 | 1..122 | 665 | 100 | Plus |
CG12012-PB | 81 | CG12012-PB | 1..81 | 42..122 | 449 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12379-PA | 120 | GI12379-PA | 3..120 | 2..122 | 456 | 73.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13248-PA | 122 | GL13248-PA | 1..122 | 1..122 | 551 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11335-PA | 122 | GA11335-PA | 1..122 | 1..122 | 551 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14571-PA | 122 | GM14571-PA | 1..122 | 1..122 | 632 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13762-PA | 122 | GD13762-PA | 1..122 | 1..122 | 638 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12269-PA | 120 | GJ12269-PA | 4..120 | 3..122 | 452 | 73.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20512-PA | 121 | GK20512-PA | 4..121 | 3..122 | 513 | 80.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21363-PA | 122 | GE21363-PA | 1..122 | 1..122 | 599 | 91.8 | Plus |