Clone IP05517 Report

Search the DGRC for IP05517

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:55
Well:17
Vector:pOT2
Associated Gene/TranscriptCG12012-RA
Protein status:IP05517.pep: gold
Preliminary Size:369
Sequenced Size:849

Clone Sequence Records

IP05517.complete Sequence

849 bp assembled on 2009-07-28

GenBank Submission: BT088924.1

> IP05517.complete
CCTAGACTATTTTCATAACAAGAAGCAGTGAGTCACAAAAAAAAAGCTTT
CCGGCCACAATGGCAGATACCCGTAAAGACGCCGCGCCGCCGAGCTACGA
AGAAGTCATGAACAGTCCCTCGCAGGATTCCCGGCTGATAGTGGGCGTGC
ATCAGGGAGCACCTAGTGCTCCGCCACCAAACATGCACATGCCAACCTAC
GGAGCTTTCGAGACGACGCCGGTCAGCGTGGTGATTCAGCCTGCTCCGGT
CGCTATGCCCACCGAGATCATCGTGATTGGAGGATGCCCTGCATGTCGGA
TTGGATACCTGGAGGACACCTTCTCCGCCTGCGGACTGTGCTGCGCAATC
TTCTTCTTCCCGCTGGGAATTCTCTGTTGCTTGGCCATGCGTGAGAAGCG
CTGTTCCAACTGCGGAACGGTTTTCTAGAGGGGATTACCCAGAAATTATC
CATAAAGAAACGCTAAAAGTTGATCCCTATTAGGCTTTCGCGGTGGGTGA
CTATCACAAAGCACCAATATTTTTGTTATTGTTAATCGTTAGCTCGCAAA
TCATTATATACTATGTGTAAATATTATTCATGCCAGCCTGCGGAATGCCC
CCGATTCCATTCCAGTCCCTGTCCGGAGAATGGTCATGTACAGTGAAATA
TGCTAAACTCGAATTCAAATCAGTAAGCCCAGTTATGAAAAAAATGCTAA
AAAAAATCAGTTGAACATGTTTTCCAATTGAATAGTGATTTGGCTTTTTA
CAAGGATTTTAAGTAACATAAGTTTTAAACTGCAAACAAAAGAAAAAATA
TTTATATATTTAAATAAAAGGTTTACAACATGAAAAAAAAAAAAAAAAA

IP05517.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12012-RA 1239 CG12012-RA 134..964 1..832 4120 99.8 Plus
CG12012.a 855 CG12012.a 38..855 1..815 3970 99.3 Plus
CG12012-RB 902 CG12012-RB 213..902 126..815 3450 100 Plus
CG12012-RB 902 CG12012-RB 38..162 1..126 590 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3376419..3377125 126..832 3520 99.9 Plus
chr3L 24539361 chr3L 3376244..3376368 1..126 580 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3376998..3377704 126..832 3535 100 Plus
3L 28110227 3L 3376823..3376947 1..126 580 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3376998..3377704 126..832 3535 100 Plus
3L 28103327 3L 3376823..3376947 1..126 590 99.2 Plus
Blast to na_te.dros performed 2019-03-16 07:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 6844..6901 818..758 117 72.6 Minus
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 60..120 770..830 116 65.6 Plus

IP05517.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:51:23 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3376244..3376368 1..126 99 -> Plus
chr3L 3376420..3377085 127..792 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:58 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RA 1..369 60..428 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:59:53 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RA 1..369 60..428 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:40:05 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RA 1..369 60..428 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:29 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RA 1..369 60..428 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:01:44 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RA 1..369 60..428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:59:53 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RA 67..880 1..815 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:40:05 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RA 67..880 1..815 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:29 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
CG12012-RC 67..897 1..832 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:23 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3376823..3376947 1..126 99 -> Plus
3L 3376999..3377704 127..832 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:23 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3376823..3376947 1..126 99 -> Plus
3L 3376999..3377704 127..832 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:23 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3376823..3376947 1..126 99 -> Plus
3L 3376999..3377704 127..832 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:40:05 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3376823..3376947 1..126 99 -> Plus
arm_3L 3376999..3377704 127..832 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:51:36 Download gff for IP05517.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3376999..3377704 127..832 100   Plus
3L 3376823..3376947 1..126 99 -> Plus

IP05517.hyp Sequence

Translation from 59 to 427

> IP05517.hyp
MADTRKDAAPPSYEEVMNSPSQDSRLIVGVHQGAPSAPPPNMHMPTYGAF
ETTPVSVVIQPAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFF
PLGILCCLAMREKRCSNCGTVF*

IP05517.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG12012-PC 122 CG12012-PC 1..122 1..122 665 100 Plus
CG12012-PA 122 CG12012-PA 1..122 1..122 665 100 Plus
CG12012-PB 81 CG12012-PB 1..81 42..122 449 100 Plus

IP05517.pep Sequence

Translation from 59 to 427

> IP05517.pep
MADTRKDAAPPSYEEVMNSPSQDSRLIVGVHQGAPSAPPPNMHMPTYGAF
ETTPVSVVIQPAPVAMPTEIIVIGGCPACRIGYLEDTFSACGLCCAIFFF
PLGILCCLAMREKRCSNCGTVF*

IP05517.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24209-PA 123 GF24209-PA 1..123 1..122 472 74.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15138-PA 122 GG15138-PA 1..122 1..122 634 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23325-PA 120 GH23325-PA 3..120 2..122 416 68.5 Plus
Dgri\GH16110-PA 120 GH16110-PA 3..120 2..122 416 68.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12012-PC 122 CG12012-PC 1..122 1..122 665 100 Plus
CG12012-PA 122 CG12012-PA 1..122 1..122 665 100 Plus
CG12012-PB 81 CG12012-PB 1..81 42..122 449 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12379-PA 120 GI12379-PA 3..120 2..122 456 73.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13248-PA 122 GL13248-PA 1..122 1..122 551 84.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11335-PA 122 GA11335-PA 1..122 1..122 551 84.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14571-PA 122 GM14571-PA 1..122 1..122 632 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13762-PA 122 GD13762-PA 1..122 1..122 638 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12269-PA 120 GJ12269-PA 4..120 3..122 452 73.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20512-PA 121 GK20512-PA 4..121 3..122 513 80.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21363-PA 122 GE21363-PA 1..122 1..122 599 91.8 Plus