Clone IP05539 Report

Search the DGRC for IP05539

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:55
Well:39
Vector:pOT2
Associated Gene/TranscriptCG13010-RA
Protein status:IP05539.pep: gold
Preliminary Size:405
Sequenced Size:674

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13010 2005-01-01 Successful iPCR screen
CG13010 2008-04-29 Release 5.5 accounting
CG13010 2008-08-15 Release 5.9 accounting
CG13010 2008-12-18 5.12 accounting

Clone Sequence Records

IP05539.complete Sequence

674 bp (674 high quality bases) assembled on 2006-01-26

GenBank Submission: BT024383

> IP05539.complete
TCCAAAAAAAAAAACGTTAAGCATAATTCCCCAAATTTCGAGCTCACGCG
AACGTGAACCACTGCCAGGATGTGCATGCCGTATTTGAGTAAGCTCTTCG
GTGGAGGCGATCGCCGGCAGCGTCGCACCCGCGATGGAGGCGTCACCCCA
CTGCCCAGCCTGGCCAATGTGACCCAGGTCTCCATGGACACCGTCAAGTC
CGCCAAGTCAGCGAAGTCAGCGAAGTCGGCTAAATCCGGCAAGTCCGCCG
GTCGCCGTAGTACCACCGCTGCCAATCCTCCTGAGTCCAGTGTCAGCAGC
AATGAGGATAATGCGGAGCAACCTCTGGCGACCGCCTCCCGAGGAGCTGT
GCGCAACGCCACCGCCTCGATGGCCACCAGTGCTGCTCCAGCCGACGAGG
CGAGGTCGCGCCGCTCCTGGTGGGGATACTTTGGCATGAGCAAGAACAAG
AAGTCCAGCATTGAGTCGCTCTAGACTGCCAAGGATCGGGATTGCAGCGA
ATTGCAATGCATATATTCAATAGGAGTTGATGGTCATCGAAATTTGGCTT
GCAGTAGTCCCCTATACACTTATCAAAAATCTTTTGCTTTTTTCGCTTTC
AAGATATTAGTTAAATAAAAATGTTCCATTTCGAACCTTTGGAACACCAA
AAAAAAAAAAAAAAAAAAAAAAAA

IP05539.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13010-RA 647 CG13010-RA 3..647 4..648 3225 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16567947..16568591 648..4 3210 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:45:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16678261..16678909 652..4 3245 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 16686359..16687007 652..4 3245 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:32:09 has no hits.

IP05539.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:32:51 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16567947..16568595 1..648 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:23 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:28 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:41:43 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:22 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:13:14 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:37 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:27 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:41:43 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 33..681 1..648 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:23 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 1..405 70..474 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:13:14 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
CG13010-RA 33..681 1..648 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:51 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
X 16678265..16678913 1..648 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:51 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
X 16678265..16678913 1..648 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:32:51 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
X 16678265..16678913 1..648 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:41:43 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16572298..16572946 1..648 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:43 Download gff for IP05539.complete
Subject Subject Range Query Range Percent Splice Strand
X 16686363..16687011 1..648 99   Minus

IP05539.pep Sequence

Translation from 69 to 473

> IP05539.pep
MCMPYLSKLFGGGDRRQRRTRDGGVTPLPSLANVTQVSMDTVKSAKSAKS
AKSAKSGKSAGRRSTTAANPPESSVSSNEDNAEQPLATASRGAVRNATAS
MATSAAPADEARSRRSWWGYFGMSKNKKSSIESL*

IP05539.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18236-PA 134 GG18236-PA 1..134 1..134 448 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13010-PA 134 CG13010-PA 1..134 1..134 672 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13378-PA 134 GM13378-PA 1..134 1..134 667 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15735-PA 134 GD15735-PA 1..134 1..134 663 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15654-PA 135 GE15654-PA 1..135 1..134 594 87.4 Plus

IP05539.hyp Sequence

Translation from 69 to 473

> IP05539.hyp
MCMPYLSKLFGGGDRRQRRTRDGGVTPLPSLANVTQVSMDTVKSAKSAKS
AKSAKSGKSAGRRSTTAANPPESSVSSNEDNAEQPLATASRGAVRNATAS
MATSAAPADEARSRRSWWGYFGMSKNKKSSIESL*

IP05539.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13010-PA 134 CG13010-PA 1..134 1..134 672 100 Plus