Clone IP05558 Report

Search the DGRC for IP05558

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:55
Well:58
Vector:pOT2
Associated Gene/TranscriptCG13426-RA
Protein status:IP05558.pep: gold
Preliminary Size:318
Sequenced Size:453

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13426 2005-01-01 Successful iPCR screen
CG13426 2008-04-29 Release 5.5 accounting
CG13426 2008-08-15 Release 5.9 accounting
CG13426 2008-12-18 5.12 accounting

Clone Sequence Records

IP05558.complete Sequence

453 bp (453 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023643

> IP05558.complete
ATTTGTTTTGCGCAAAACAAGCGACTGATATACTCAGATATTCGAACGAA
TCAAAAGATGGAGCAACTACTTTCTCGTCGCCGCAGATACAGGGCCAAAT
GTGCCAAGAGGAGTGTCCGCAAATTCTTACCCGATTTGAAGTGCAAGTCT
GTGGAACGCATTAAATGCCAGATTAAGGATCTGCTGATCTTAATGGTTCC
GTCCAAGGATTTCTATAAGAACTCGTTGCGGTTCTACAAGCGCTGCACAA
AACCAGATCGTCGGGAGTTCCAGCGTATCAGCATTGGCATTGGCGTAGGA
TTCCTTATCATGGGCTTGATTGGATTCGTCGTTAAGCTGATGCACATACC
CATAGTCAACATCATCATGGACTGAGGGCTAAAACTCGAGTGGAAATAAA
GGTTCAATTCCGCTTCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

IP05558.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-RA 635 CG13426-RA 59..479 1..421 2105 100 Plus
CG13426.a 871 CG13426.a 152..553 1..402 2010 100 Plus
CG13426.b 1127 CG13426.b 152..553 1..402 2010 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16399497..16399806 418..109 1475 98.4 Minus
chr2R 21145070 chr2R 16399859..16399969 111..1 555 100 Minus
chr2R 21145070 chr2R 8066810..8066942 370..238 200 76.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20512694..20513006 421..109 1565 100 Minus
2R 25286936 2R 20513059..20513169 111..1 555 100 Minus
2R 25286936 2R 12179595..12179727 370..238 200 76.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20513893..20514205 421..109 1565 100 Minus
2R 25260384 2R 20514258..20514368 111..1 555 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:23:47 has no hits.

IP05558.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:24:59 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16399497..16399804 111..418 98 <- Minus
chr2R 16399860..16399969 1..110 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:24 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:01:23 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:45 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:51 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:02 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..318 58..375 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:31 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:01:23 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:45 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:51 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..418 1..418 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:02 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
CG13426-RA 1..418 1..418 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:59 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20512697..20513004 111..418 100 <- Minus
2R 20513060..20513169 1..110 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:59 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20512697..20513004 111..418 100 <- Minus
2R 20513060..20513169 1..110 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:59 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20512697..20513004 111..418 100 <- Minus
2R 20513060..20513169 1..110 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:45 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16400202..16400509 111..418 100 <- Minus
arm_2R 16400565..16400674 1..110 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:20:54 Download gff for IP05558.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20513896..20514203 111..418 100 <- Minus
2R 20514259..20514368 1..110 100   Minus

IP05558.hyp Sequence

Translation from 0 to 374

> IP05558.hyp
ICFAQNKRLIYSDIRTNQKMEQLLSRRRRYRAKCAKRSVRKFLPDLKCKS
VERIKCQIKDLLILMVPSKDFYKNSLRFYKRCTKPDRREFQRISIGIGVG
FLIMGLIGFVVKLMHIPIVNIIMD*

IP05558.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 105 CG13426-PA 1..105 20..124 538 100 Plus
Sec61gamma-PC 68 CG14214-PC 10..66 67..123 196 64.9 Plus
Sec61gamma-PB 68 CG14214-PB 10..66 67..123 196 64.9 Plus
Sec61gamma-PA 68 CG14214-PA 10..66 67..123 196 64.9 Plus
CG8860-PA 68 CG8860-PA 10..66 67..123 196 64.9 Plus

IP05558.pep Sequence

Translation from 57 to 374

> IP05558.pep
MEQLLSRRRRYRAKCAKRSVRKFLPDLKCKSVERIKCQIKDLLILMVPSK
DFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIV
NIIMD*

IP05558.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12667-PA 105 GF12667-PA 1..104 1..104 323 59.6 Plus
Dana\GF20416-PA 68 GF20416-PA 10..66 48..104 198 63.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20863-PA 105 GG20863-PA 1..105 1..105 426 80 Plus
Dere\GG22600-PA 68 GG22600-PA 10..66 48..104 202 64.9 Plus
Dere\GG19242-PA 68 GG19242-PA 10..66 48..104 198 64.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21072-PA 169 GH21072-PA 54..103 52..101 172 62 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13426-PA 105 CG13426-PA 1..105 1..105 538 100 Plus
Sec61gamma-PC 68 CG14214-PC 10..66 48..104 196 64.9 Plus
Sec61gamma-PB 68 CG14214-PB 10..66 48..104 196 64.9 Plus
Sec61gamma-PA 68 CG14214-PA 10..66 48..104 196 64.9 Plus
CG8860-PA 68 CG8860-PA 10..66 48..104 196 64.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18672-PA 111 GI18672-PA 1..110 1..104 199 49.1 Plus
Dmoj\GI21533-PA 68 GI21533-PA 10..66 48..104 198 63.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27062-PA 68 GL27062-PA 10..66 48..104 198 63.2 Plus
Dper\GL16814-PA 126 GL16814-PA 32..118 16..100 179 41.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12829-PA 68 GA12829-PA 10..66 48..104 198 63.2 Plus
Dpse\GA24304-PB 105 GA24304-PB 4..97 5..100 171 40.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19788-PA 105 GM19788-PA 1..105 1..105 481 88.6 Plus
Dsec\GM20379-PA 68 GM20379-PA 10..66 48..104 202 64.9 Plus
Dsec\GM22977-PA 68 GM22977-PA 10..66 48..104 200 64.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25279-PA 105 GD25279-PA 1..105 1..105 472 87.6 Plus
Dsim\GD15244-PA 68 GD15244-PA 10..66 48..104 202 64.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21688-PA 107 GJ21688-PA 18..106 19..104 203 46.1 Plus
Dvir\GJ16006-PA 68 GJ16006-PA 10..66 48..104 198 63.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16225-PA 68 GK16225-PA 10..66 48..104 198 63.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13801-PA 105 GE13801-PA 1..105 1..105 433 80 Plus
Dyak\GE13468-PA 68 GE13468-PA 10..66 48..104 202 64.9 Plus
Dyak\GE15861-PA 68 GE15861-PA 10..66 48..104 200 64.9 Plus