BDGP Sequence Production Resources |
Search the DGRC for IP05558
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 55 |
Well: | 58 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13426-RA |
Protein status: | IP05558.pep: gold |
Preliminary Size: | 318 |
Sequenced Size: | 453 |
Gene | Date | Evidence |
---|---|---|
CG13426 | 2005-01-01 | Successful iPCR screen |
CG13426 | 2008-04-29 | Release 5.5 accounting |
CG13426 | 2008-08-15 | Release 5.9 accounting |
CG13426 | 2008-12-18 | 5.12 accounting |
453 bp (453 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023643
> IP05558.complete ATTTGTTTTGCGCAAAACAAGCGACTGATATACTCAGATATTCGAACGAA TCAAAAGATGGAGCAACTACTTTCTCGTCGCCGCAGATACAGGGCCAAAT GTGCCAAGAGGAGTGTCCGCAAATTCTTACCCGATTTGAAGTGCAAGTCT GTGGAACGCATTAAATGCCAGATTAAGGATCTGCTGATCTTAATGGTTCC GTCCAAGGATTTCTATAAGAACTCGTTGCGGTTCTACAAGCGCTGCACAA AACCAGATCGTCGGGAGTTCCAGCGTATCAGCATTGGCATTGGCGTAGGA TTCCTTATCATGGGCTTGATTGGATTCGTCGTTAAGCTGATGCACATACC CATAGTCAACATCATCATGGACTGAGGGCTAAAACTCGAGTGGAAATAAA GGTTCAATTCCGCTTCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 16399497..16399806 | 418..109 | 1475 | 98.4 | Minus |
chr2R | 21145070 | chr2R | 16399859..16399969 | 111..1 | 555 | 100 | Minus |
chr2R | 21145070 | chr2R | 8066810..8066942 | 370..238 | 200 | 76.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 20512694..20513006 | 421..109 | 1565 | 100 | Minus |
2R | 25286936 | 2R | 20513059..20513169 | 111..1 | 555 | 100 | Minus |
2R | 25286936 | 2R | 12179595..12179727 | 370..238 | 200 | 76.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 16399497..16399804 | 111..418 | 98 | <- | Minus |
chr2R | 16399860..16399969 | 1..110 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..318 | 58..375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..318 | 58..375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..318 | 58..375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..318 | 58..375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..318 | 58..375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..418 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..418 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..418 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..418 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13426-RA | 1..418 | 1..418 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20512697..20513004 | 111..418 | 100 | <- | Minus |
2R | 20513060..20513169 | 1..110 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20512697..20513004 | 111..418 | 100 | <- | Minus |
2R | 20513060..20513169 | 1..110 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20512697..20513004 | 111..418 | 100 | <- | Minus |
2R | 20513060..20513169 | 1..110 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 16400202..16400509 | 111..418 | 100 | <- | Minus |
arm_2R | 16400565..16400674 | 1..110 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 20513896..20514203 | 111..418 | 100 | <- | Minus |
2R | 20514259..20514368 | 1..110 | 100 | Minus |
Translation from 0 to 374
> IP05558.hyp ICFAQNKRLIYSDIRTNQKMEQLLSRRRRYRAKCAKRSVRKFLPDLKCKS VERIKCQIKDLLILMVPSKDFYKNSLRFYKRCTKPDRREFQRISIGIGVG FLIMGLIGFVVKLMHIPIVNIIMD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13426-PA | 105 | CG13426-PA | 1..105 | 20..124 | 538 | 100 | Plus |
Sec61gamma-PC | 68 | CG14214-PC | 10..66 | 67..123 | 196 | 64.9 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 10..66 | 67..123 | 196 | 64.9 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 10..66 | 67..123 | 196 | 64.9 | Plus |
CG8860-PA | 68 | CG8860-PA | 10..66 | 67..123 | 196 | 64.9 | Plus |
Translation from 57 to 374
> IP05558.pep MEQLLSRRRRYRAKCAKRSVRKFLPDLKCKSVERIKCQIKDLLILMVPSK DFYKNSLRFYKRCTKPDRREFQRISIGIGVGFLIMGLIGFVVKLMHIPIV NIIMD*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12667-PA | 105 | GF12667-PA | 1..104 | 1..104 | 323 | 59.6 | Plus |
Dana\GF20416-PA | 68 | GF20416-PA | 10..66 | 48..104 | 198 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20863-PA | 105 | GG20863-PA | 1..105 | 1..105 | 426 | 80 | Plus |
Dere\GG22600-PA | 68 | GG22600-PA | 10..66 | 48..104 | 202 | 64.9 | Plus |
Dere\GG19242-PA | 68 | GG19242-PA | 10..66 | 48..104 | 198 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21072-PA | 169 | GH21072-PA | 54..103 | 52..101 | 172 | 62 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13426-PA | 105 | CG13426-PA | 1..105 | 1..105 | 538 | 100 | Plus |
Sec61gamma-PC | 68 | CG14214-PC | 10..66 | 48..104 | 196 | 64.9 | Plus |
Sec61gamma-PB | 68 | CG14214-PB | 10..66 | 48..104 | 196 | 64.9 | Plus |
Sec61gamma-PA | 68 | CG14214-PA | 10..66 | 48..104 | 196 | 64.9 | Plus |
CG8860-PA | 68 | CG8860-PA | 10..66 | 48..104 | 196 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18672-PA | 111 | GI18672-PA | 1..110 | 1..104 | 199 | 49.1 | Plus |
Dmoj\GI21533-PA | 68 | GI21533-PA | 10..66 | 48..104 | 198 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL27062-PA | 68 | GL27062-PA | 10..66 | 48..104 | 198 | 63.2 | Plus |
Dper\GL16814-PA | 126 | GL16814-PA | 32..118 | 16..100 | 179 | 41.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12829-PA | 68 | GA12829-PA | 10..66 | 48..104 | 198 | 63.2 | Plus |
Dpse\GA24304-PB | 105 | GA24304-PB | 4..97 | 5..100 | 171 | 40.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19788-PA | 105 | GM19788-PA | 1..105 | 1..105 | 481 | 88.6 | Plus |
Dsec\GM20379-PA | 68 | GM20379-PA | 10..66 | 48..104 | 202 | 64.9 | Plus |
Dsec\GM22977-PA | 68 | GM22977-PA | 10..66 | 48..104 | 200 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25279-PA | 105 | GD25279-PA | 1..105 | 1..105 | 472 | 87.6 | Plus |
Dsim\GD15244-PA | 68 | GD15244-PA | 10..66 | 48..104 | 202 | 64.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21688-PA | 107 | GJ21688-PA | 18..106 | 19..104 | 203 | 46.1 | Plus |
Dvir\GJ16006-PA | 68 | GJ16006-PA | 10..66 | 48..104 | 198 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16225-PA | 68 | GK16225-PA | 10..66 | 48..104 | 198 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13801-PA | 105 | GE13801-PA | 1..105 | 1..105 | 433 | 80 | Plus |
Dyak\GE13468-PA | 68 | GE13468-PA | 10..66 | 48..104 | 202 | 64.9 | Plus |
Dyak\GE15861-PA | 68 | GE15861-PA | 10..66 | 48..104 | 200 | 64.9 | Plus |