IP05560.complete Sequence
499 bp (499 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023644
> IP05560.complete
TCATTTTCAACCATTTTAGTGAGCCGTAAGAACGTGACAGCTCGGAAATG
AAGCTACTCTGCGTTGTTTTGGTTATTTACGTTGTGGCTCTGACCCTCTT
CGGAGTCGATGGACGTGGTGGGGGCACCACAAATGGAGTGGAGGAACCAA
AGTTCGTCGGTTTGTTCAGGCGGGCAAGGCGCCATGTCCCCGCAATGAAA
ACCGCCCTTCTTCACGGCAACGAACCGCCTCCACCTCCGAAATTCCGATC
CCGTCGTGATACATTGGAGGACAAGCTCGTGGCCAATGATGATCCTCCAC
CACCGCCGCAGTTCAGACAACGTCGTCAGGCTCCACCTGGAATGCCACCA
CCGCCGGACGGCCTTCCACCACCACCCCAGTTCCTTCTCTAAAGTAATGT
AAAGCATAAAGTTGGGCGTTTGTGCATGTATTTGGGAACCACATCGAAGC
TAATAAAAGTAGTTTGAAGCATTCCAAAAATGAAAAAAAAAAAAAAAAA
IP05560.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:46:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13428-RA | 692 | CG13428-RA | 74..556 | 1..483 | 2415 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:42:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 16426268..16426432 | 482..318 | 810 | 99.4 | Minus |
chr2R | 21145070 | chr2R | 16427061..16427204 | 144..1 | 690 | 98.6 | Minus |
chr2R | 21145070 | chr2R | 16426721..16426796 | 248..173 | 365 | 98.7 | Minus |
chr2R | 21145070 | chr2R | 16426501..16426569 | 317..249 | 345 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:42:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20539511..20539676 | 483..318 | 830 | 100 | Minus |
2R | 25286936 | 2R | 20540305..20540448 | 144..1 | 720 | 100 | Minus |
2R | 25286936 | 2R | 20539965..20540040 | 248..173 | 380 | 100 | Minus |
2R | 25286936 | 2R | 20539745..20539813 | 317..249 | 345 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 20540710..20540875 | 483..318 | 830 | 100 | Minus |
2R | 25260384 | 2R | 20541504..20541647 | 144..1 | 720 | 100 | Minus |
2R | 25260384 | 2R | 20541164..20541239 | 248..173 | 380 | 100 | Minus |
2R | 25260384 | 2R | 20540944..20541012 | 317..249 | 345 | 100 | Minus |
2R | 25260384 | 2R | 20541419..20541451 | 174..142 | 165 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 09:42:20 has no hits.
IP05560.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:43:16 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 16426268..16426432 | 318..482 | 99 | <- | Minus |
chr2R | 16426501..16426569 | 249..317 | 100 | <- | Minus |
chr2R | 16426721..16426795 | 174..248 | 98 | <- | Minus |
chr2R | 16426977..16427006 | 144..173 | 100 | <- | Minus |
chr2R | 16427062..16427204 | 1..143 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:25 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..345 | 48..392 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:06:36 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..345 | 48..392 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:11 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..345 | 48..392 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:52 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..345 | 48..392 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:32 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..345 | 48..392 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:33 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..482 | 1..482 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:06:36 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..482 | 1..482 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:11 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..482 | 1..482 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:52 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..482 | 1..482 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:32 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13428-RA | 1..482 | 1..482 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:16 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20539512..20539676 | 318..482 | 100 | <- | Minus |
2R | 20539745..20539813 | 249..317 | 100 | <- | Minus |
2R | 20539965..20540039 | 174..248 | 100 | <- | Minus |
2R | 20540221..20540250 | 144..173 | 100 | <- | Minus |
2R | 20540306..20540448 | 1..143 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:16 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20539512..20539676 | 318..482 | 100 | <- | Minus |
2R | 20539745..20539813 | 249..317 | 100 | <- | Minus |
2R | 20539965..20540039 | 174..248 | 100 | <- | Minus |
2R | 20540221..20540250 | 144..173 | 100 | <- | Minus |
2R | 20540306..20540448 | 1..143 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:16 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20539512..20539676 | 318..482 | 100 | <- | Minus |
2R | 20539745..20539813 | 249..317 | 100 | <- | Minus |
2R | 20539965..20540039 | 174..248 | 100 | <- | Minus |
2R | 20540221..20540250 | 144..173 | 100 | <- | Minus |
2R | 20540306..20540448 | 1..143 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:11 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16427017..16427181 | 318..482 | 100 | <- | Minus |
arm_2R | 16427250..16427318 | 249..317 | 100 | <- | Minus |
arm_2R | 16427470..16427544 | 174..248 | 100 | <- | Minus |
arm_2R | 16427726..16427755 | 144..173 | 100 | <- | Minus |
arm_2R | 16427811..16427953 | 1..143 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:26:25 Download gff for
IP05560.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20540711..20540875 | 318..482 | 100 | <- | Minus |
2R | 20540944..20541012 | 249..317 | 100 | <- | Minus |
2R | 20541164..20541238 | 174..248 | 100 | <- | Minus |
2R | 20541420..20541449 | 144..173 | 100 | <- | Minus |
2R | 20541505..20541647 | 1..143 | 100 | | Minus |
IP05560.hyp Sequence
Translation from 47 to 391
> IP05560.hyp
MKLLCVVLVIYVVALTLFGVDGRGGGTTNGVEEPKFVGLFRRARRHVPAM
KTALLHGNEPPPPPKFRSRRDTLEDKLVANDDPPPPPQFRQRRQAPPGMP
PPPDGLPPPPQFLL*
IP05560.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13428-PA | 114 | CG13428-PA | 1..114 | 1..114 | 620 | 100 | Plus |
CG13428-PB | 89 | CG13428-PB | 1..89 | 1..114 | 444 | 78.1 | Plus |
IP05560.pep Sequence
Translation from 47 to 391
> IP05560.pep
MKLLCVVLVIYVVALTLFGVDGRGGGTTNGVEEPKFVGLFRRARRHVPAM
KTALLHGNEPPPPPKFRSRRDTLEDKLVANDDPPPPPQFRQRRQAPPGMP
PPPDGLPPPPQFLL*
IP05560.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:07:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF12665-PA | 123 | GF12665-PA | 1..107 | 1..105 | 300 | 81.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:07:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20860-PA | 113 | GG20860-PA | 1..113 | 1..114 | 289 | 67.5 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:07:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH21067-PA | 119 | GH21067-PA | 1..117 | 1..109 | 227 | 50 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13428-PA | 114 | CG13428-PA | 1..114 | 1..114 | 620 | 100 | Plus |
CG13428-PB | 89 | CG13428-PB | 1..89 | 1..114 | 444 | 78.1 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:07:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI18668-PA | 129 | GI18668-PA | 1..95 | 1..89 | 161 | 49.5 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:07:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL16810-PA | 109 | GL16810-PA | 1..92 | 1..95 | 290 | 62.2 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:07:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12281-PA | 109 | GA12281-PA | 1..92 | 1..95 | 290 | 62.2 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:07:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19785-PA | 114 | GM19785-PA | 1..114 | 1..114 | 393 | 94.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:07:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK20994-PA | 99 | GK20994-PA | 1..72 | 10..98 | 140 | 49.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:07:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13798-PA | 139 | GE13798-PA | 1..139 | 1..114 | 374 | 70.5 | Plus |