Clone IP05560 Report

Search the DGRC for IP05560

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:55
Well:60
Vector:pOT2
Associated Gene/TranscriptCG13428-RA
Protein status:IP05560.pep: gold
Preliminary Size:345
Sequenced Size:499

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13428 2005-01-01 Successful iPCR screen
CG13428 2008-04-29 Release 5.5 accounting
CG13428 2008-08-15 Release 5.9 accounting
CG13428 2008-12-18 5.12 accounting

Clone Sequence Records

IP05560.complete Sequence

499 bp (499 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023644

> IP05560.complete
TCATTTTCAACCATTTTAGTGAGCCGTAAGAACGTGACAGCTCGGAAATG
AAGCTACTCTGCGTTGTTTTGGTTATTTACGTTGTGGCTCTGACCCTCTT
CGGAGTCGATGGACGTGGTGGGGGCACCACAAATGGAGTGGAGGAACCAA
AGTTCGTCGGTTTGTTCAGGCGGGCAAGGCGCCATGTCCCCGCAATGAAA
ACCGCCCTTCTTCACGGCAACGAACCGCCTCCACCTCCGAAATTCCGATC
CCGTCGTGATACATTGGAGGACAAGCTCGTGGCCAATGATGATCCTCCAC
CACCGCCGCAGTTCAGACAACGTCGTCAGGCTCCACCTGGAATGCCACCA
CCGCCGGACGGCCTTCCACCACCACCCCAGTTCCTTCTCTAAAGTAATGT
AAAGCATAAAGTTGGGCGTTTGTGCATGTATTTGGGAACCACATCGAAGC
TAATAAAAGTAGTTTGAAGCATTCCAAAAATGAAAAAAAAAAAAAAAAA

IP05560.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13428-RA 692 CG13428-RA 74..556 1..483 2415 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16426268..16426432 482..318 810 99.4 Minus
chr2R 21145070 chr2R 16427061..16427204 144..1 690 98.6 Minus
chr2R 21145070 chr2R 16426721..16426796 248..173 365 98.7 Minus
chr2R 21145070 chr2R 16426501..16426569 317..249 345 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20539511..20539676 483..318 830 100 Minus
2R 25286936 2R 20540305..20540448 144..1 720 100 Minus
2R 25286936 2R 20539965..20540040 248..173 380 100 Minus
2R 25286936 2R 20539745..20539813 317..249 345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20540710..20540875 483..318 830 100 Minus
2R 25260384 2R 20541504..20541647 144..1 720 100 Minus
2R 25260384 2R 20541164..20541239 248..173 380 100 Minus
2R 25260384 2R 20540944..20541012 317..249 345 100 Minus
2R 25260384 2R 20541419..20541451 174..142 165 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:42:20 has no hits.

IP05560.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:43:16 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16426268..16426432 318..482 99 <- Minus
chr2R 16426501..16426569 249..317 100 <- Minus
chr2R 16426721..16426795 174..248 98 <- Minus
chr2R 16426977..16427006 144..173 100 <- Minus
chr2R 16427062..16427204 1..143 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:25 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:06:36 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:11 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:59:52 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:32 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..345 48..392 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:13:33 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..482 1..482 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:06:36 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..482 1..482 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:11 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..482 1..482 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:59:52 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..482 1..482 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:32 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
CG13428-RA 1..482 1..482 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:16 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20539512..20539676 318..482 100 <- Minus
2R 20539745..20539813 249..317 100 <- Minus
2R 20539965..20540039 174..248 100 <- Minus
2R 20540221..20540250 144..173 100 <- Minus
2R 20540306..20540448 1..143 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:16 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20539512..20539676 318..482 100 <- Minus
2R 20539745..20539813 249..317 100 <- Minus
2R 20539965..20540039 174..248 100 <- Minus
2R 20540221..20540250 144..173 100 <- Minus
2R 20540306..20540448 1..143 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:16 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20539512..20539676 318..482 100 <- Minus
2R 20539745..20539813 249..317 100 <- Minus
2R 20539965..20540039 174..248 100 <- Minus
2R 20540221..20540250 144..173 100 <- Minus
2R 20540306..20540448 1..143 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:11 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16427017..16427181 318..482 100 <- Minus
arm_2R 16427250..16427318 249..317 100 <- Minus
arm_2R 16427470..16427544 174..248 100 <- Minus
arm_2R 16427726..16427755 144..173 100 <- Minus
arm_2R 16427811..16427953 1..143 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:26:25 Download gff for IP05560.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20540711..20540875 318..482 100 <- Minus
2R 20540944..20541012 249..317 100 <- Minus
2R 20541164..20541238 174..248 100 <- Minus
2R 20541420..20541449 144..173 100 <- Minus
2R 20541505..20541647 1..143 100   Minus

IP05560.hyp Sequence

Translation from 47 to 391

> IP05560.hyp
MKLLCVVLVIYVVALTLFGVDGRGGGTTNGVEEPKFVGLFRRARRHVPAM
KTALLHGNEPPPPPKFRSRRDTLEDKLVANDDPPPPPQFRQRRQAPPGMP
PPPDGLPPPPQFLL*

IP05560.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13428-PA 114 CG13428-PA 1..114 1..114 620 100 Plus
CG13428-PB 89 CG13428-PB 1..89 1..114 444 78.1 Plus

IP05560.pep Sequence

Translation from 47 to 391

> IP05560.pep
MKLLCVVLVIYVVALTLFGVDGRGGGTTNGVEEPKFVGLFRRARRHVPAM
KTALLHGNEPPPPPKFRSRRDTLEDKLVANDDPPPPPQFRQRRQAPPGMP
PPPDGLPPPPQFLL*

IP05560.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12665-PA 123 GF12665-PA 1..107 1..105 300 81.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20860-PA 113 GG20860-PA 1..113 1..114 289 67.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21067-PA 119 GH21067-PA 1..117 1..109 227 50 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13428-PA 114 CG13428-PA 1..114 1..114 620 100 Plus
CG13428-PB 89 CG13428-PB 1..89 1..114 444 78.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18668-PA 129 GI18668-PA 1..95 1..89 161 49.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16810-PA 109 GL16810-PA 1..92 1..95 290 62.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12281-PA 109 GA12281-PA 1..92 1..95 290 62.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19785-PA 114 GM19785-PA 1..114 1..114 393 94.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20994-PA 99 GK20994-PA 1..72 10..98 140 49.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:07:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13798-PA 139 GE13798-PA 1..139 1..114 374 70.5 Plus