Clone IP05601 Report

Search the DGRC for IP05601

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:56
Well:1
Vector:pOT2
Associated Gene/TranscriptCG14298-RA
Protein status:IP05601.pep: gold
Preliminary Size:336
Sequenced Size:715

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14298 2005-01-01 Successful iPCR screen
CG14298 2008-04-29 Release 5.5 accounting
CG14298 2008-08-15 Release 5.9 accounting
CG14298 2008-12-18 5.12 accounting

Clone Sequence Records

IP05601.complete Sequence

715 bp (715 high quality bases) assembled on 2005-03-24

GenBank Submission: BT022409

> IP05601.complete
CGAGTACCACGAACAGCTGCTACCATTGGTGCTTCGATTCCCATCCTCAT
TCCGTTGTCGGTGGCCGCGCTAAAAACATGAAATTGAAAATCAATCTGAC
GTTCCTCCGTGCGACACTCGTCGGTCTCCTGTCCATCATCCTCCTGACAC
AGACCGCGCATATCGAGGCCTTTGGAAGCGGAGGCAGCTCTTCTGGCAAT
GGGGCAGTGGTGTCGTGCAAAGAGCTGAACAATTTCAACTGCTATGTGGG
CCGCAACGAGGGTAACTTTTGCAGCAGGAAGGATCAGACCAAGGTCGTTA
CACGCTGGTACTTCGACAAGGGCGTCTGCAAGCCCTTCAACTATAAAGGA
TGCAACGGCAATCGCAATCGCTTCTGCTCGCAGGAAAGCTGCGATGCACG
CTGCGGCGATTGATTGACATCGGTGGATACATCGTACTATATAGATATAT
AGATACATCTTACCTAGGCGATAAGTTTGTACGCGTATGTTTAGCAATTA
GAGATCTTTTCGAACTTAAAGAAAAAAAAAACGTTATTTACTAGATACTT
TAAAACTCAAGCACTTTGCACAATTACTTACAATTCATACATTAAAATAT
GATTTTTTTCACATCTCCCTCAACTTTTATTTTAAGAGTTAAATGCTTTT
ACTACAAATCTAAATAAAAATTTAAAAAAAAAATGTAATTTCCATAAAAA
AAAAAAAAAAAAAAA

IP05601.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-RA 927 CG14298-RA 231..927 1..697 3485 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14700735..14701201 229..695 2335 100 Plus
chr3R 27901430 chr3R 14699705..14699932 1..228 1140 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:46:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18876738..18877206 229..697 2345 100 Plus
3R 32079331 3R 18875708..18875935 1..228 1140 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18617569..18618037 229..697 2345 100 Plus
3R 31820162 3R 18616539..18616766 1..228 1140 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:51:27 has no hits.

IP05601.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:52:35 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14699705..14699932 1..228 100 -> Plus
chr3R 14700735..14701166 229..660 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:27:30 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:12 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:31 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:08 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:52:12 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..336 78..413 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:57:05 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..695 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:12 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..695 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:31 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..695 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:08 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..695 1..695 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:52:12 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
CG14298-RA 1..695 1..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:35 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18875708..18875935 1..228 100 -> Plus
3R 18876738..18877204 229..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:35 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18875708..18875935 1..228 100 -> Plus
3R 18876738..18877204 229..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:52:35 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18875708..18875935 1..228 100 -> Plus
3R 18876738..18877204 229..695 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:31 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14701430..14701657 1..228 100 -> Plus
arm_3R 14702460..14702926 229..695 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:02 Download gff for IP05601.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18616539..18616766 1..228 100 -> Plus
3R 18617569..18618035 229..695 100   Plus

IP05601.hyp Sequence

Translation from 2 to 412

> IP05601.hyp
STTNSCYHWCFDSHPHSVVGGRAKNMKLKINLTFLRATLVGLLSIILLTQ
TAHIEAFGSGGSSSGNGAVVSCKELNNFNCYVGRNEGNFCSRKDQTKVVT
RWYFDKGVCKPFNYKGCNGNRNRFCSQESCDARCGD*

IP05601.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-PB 111 CG14298-PB 1..111 26..136 604 100 Plus
CG14298-PA 111 CG14298-PA 1..111 26..136 604 100 Plus

IP05601.pep Sequence

Translation from 77 to 412

> IP05601.pep
MKLKINLTFLRATLVGLLSIILLTQTAHIEAFGSGGSSSGNGAVVSCKEL
NNFNCYVGRNEGNFCSRKDQTKVVTRWYFDKGVCKPFNYKGCNGNRNRFC
SQESCDARCGD*

IP05601.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:38:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23216-PA 112 GF23216-PA 1..111 1..111 452 81.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23070-PA 109 GG23070-PA 1..109 1..111 524 91.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14472-PA 104 GH14472-PA 1..103 1..111 400 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG14298-PB 111 CG14298-PB 1..111 1..111 604 100 Plus
CG14298-PA 111 CG14298-PA 1..111 1..111 604 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22965-PA 104 GI22965-PA 1..103 1..111 386 66.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23437-PA 105 GL23437-PA 1..104 1..111 411 73.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12887-PA 105 GA12887-PA 1..104 1..111 442 78.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17891-PA 111 GM17891-PA 1..111 1..111 561 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19252-PA 111 GD19252-PA 1..111 1..111 513 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14543-PA 104 GJ14543-PA 1..102 1..110 379 66.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22741-PA 108 GK22741-PA 1..107 1..111 410 71.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25561-PA 109 GE25561-PA 1..109 1..111 507 89.2 Plus